NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138264_1613185

Scaffold Ga0138264_1613185


Overview

Basic Information
Taxon OID3300012414 Open in IMG/M
Scaffold IDGa0138264_1613185 Open in IMG/M
Source Dataset NameMetatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition

Source Dataset Sampling Location
Location NameAntarctica
CoordinatesLat. (o)-64.7711Long. (o)-64.056Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049662Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0138264_16131851F049662N/AMRSVIQDFATEGEHGKDSGKNAAGEDLEGTPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGNYWAKTWRHYDV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.