NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049662

Metagenome / Metatranscriptome Family F049662

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049662
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 94 residues
Representative Sequence MRSVIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Number of Associated Samples 110
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 3.42 %
% of genes near scaffold ends (potentially truncated) 35.62 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (59.589 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(25.343 % of family members)
Environment Ontology (ENVO) Unclassified
(65.068 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.233 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.40%    β-sheet: 10.40%    Coil/Unstructured: 43.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A59.59 %
All OrganismsrootAll Organisms40.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000368|DelMOSpr2010DRAFT_102207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300000949|BBAY94_10112535Not Available744Open in IMG/M
3300000973|BBAY93_10109502Not Available701Open in IMG/M
3300003304|Ga0005273J48911_1046416Not Available606Open in IMG/M
3300005838|Ga0008649_10331064Not Available565Open in IMG/M
3300006382|Ga0075494_1021053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300006399|Ga0075495_1022511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1083Open in IMG/M
3300006419|Ga0075496_1497816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum911Open in IMG/M
3300006424|Ga0075497_1021199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300006424|Ga0075497_1516527Not Available874Open in IMG/M
3300007558|Ga0102822_1128790Not Available597Open in IMG/M
3300007692|Ga0102823_1088525Not Available821Open in IMG/M
3300007715|Ga0102827_1126133Not Available584Open in IMG/M
3300008938|Ga0103741_1119263Not Available536Open in IMG/M
3300009003|Ga0102813_1108815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum880Open in IMG/M
3300009003|Ga0102813_1154886Not Available714Open in IMG/M
3300009003|Ga0102813_1285115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300009055|Ga0102905_1141281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300009079|Ga0102814_10336441Not Available821Open in IMG/M
3300009263|Ga0103872_1026245Not Available749Open in IMG/M
3300009432|Ga0115005_10815993Not Available751Open in IMG/M
3300009432|Ga0115005_10826895Not Available746Open in IMG/M
3300009432|Ga0115005_11014595Not Available672Open in IMG/M
3300009436|Ga0115008_10559286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum821Open in IMG/M
3300009436|Ga0115008_10913636Not Available650Open in IMG/M
3300009441|Ga0115007_11072944Not Available556Open in IMG/M
3300009497|Ga0115569_10519546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300009505|Ga0115564_10292258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium818Open in IMG/M
3300009507|Ga0115572_10320449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300009599|Ga0115103_1883954Not Available619Open in IMG/M
3300009677|Ga0115104_10627335Not Available670Open in IMG/M
3300009677|Ga0115104_10706433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300009677|Ga0115104_11051769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300009679|Ga0115105_11190498Not Available636Open in IMG/M
3300012408|Ga0138265_1021098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300012412|Ga0138266_1380691Not Available765Open in IMG/M
3300012414|Ga0138264_1613185Not Available509Open in IMG/M
3300012415|Ga0138263_1257387Not Available580Open in IMG/M
3300012415|Ga0138263_1645166Not Available684Open in IMG/M
3300012416|Ga0138259_1113751Not Available651Open in IMG/M
3300012416|Ga0138259_1419154Not Available584Open in IMG/M
3300012417|Ga0138262_1876030Not Available516Open in IMG/M
3300012418|Ga0138261_1714468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300012767|Ga0138267_1153285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300012767|Ga0138267_1241527Not Available587Open in IMG/M
3300012952|Ga0163180_10611885Not Available830Open in IMG/M
3300018681|Ga0193206_1020630Not Available727Open in IMG/M
3300018871|Ga0192978_1065821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300018871|Ga0192978_1075149Not Available622Open in IMG/M
3300018874|Ga0192977_1088916Not Available619Open in IMG/M
3300018899|Ga0193090_1107913Not Available631Open in IMG/M
3300018977|Ga0193353_10251289Not Available503Open in IMG/M
3300018980|Ga0192961_10145278Not Available722Open in IMG/M
3300018980|Ga0192961_10226160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300019021|Ga0192982_10312415Not Available564Open in IMG/M
3300019022|Ga0192951_10236101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300019022|Ga0192951_10351163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300019027|Ga0192909_10159318Not Available643Open in IMG/M
3300019031|Ga0193516_10207361Not Available648Open in IMG/M
3300019031|Ga0193516_10255522Not Available569Open in IMG/M
3300019033|Ga0193037_10272530Not Available591Open in IMG/M
3300019033|Ga0193037_10373376Not Available504Open in IMG/M
3300019039|Ga0193123_10404891Not Available534Open in IMG/M
3300019048|Ga0192981_10198597Not Available783Open in IMG/M
3300019048|Ga0192981_10200291Not Available779Open in IMG/M
3300019048|Ga0192981_10224348Not Available727Open in IMG/M
3300019050|Ga0192966_10190952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300019262|Ga0182066_1021830Not Available616Open in IMG/M
3300021169|Ga0206687_1373616Not Available668Open in IMG/M
3300021169|Ga0206687_1606539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300021169|Ga0206687_1619141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300021169|Ga0206687_1660179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300021350|Ga0206692_1678299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300021359|Ga0206689_10339160Not Available661Open in IMG/M
3300021359|Ga0206689_10552534Not Available531Open in IMG/M
3300021889|Ga0063089_1033210Not Available628Open in IMG/M
3300021894|Ga0063099_1035563Not Available616Open in IMG/M
3300021906|Ga0063087_1060741Not Available582Open in IMG/M
3300021913|Ga0063104_1029905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300021941|Ga0063102_1000955Not Available694Open in IMG/M
3300021941|Ga0063102_1011172Not Available685Open in IMG/M
3300021942|Ga0063098_1061153Not Available712Open in IMG/M
3300021942|Ga0063098_1063798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300021959|Ga0222716_10383497Not Available822Open in IMG/M
3300023566|Ga0228679_1035758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300023674|Ga0228697_120171Not Available625Open in IMG/M
3300023676|Ga0232114_120074Not Available653Open in IMG/M
3300023698|Ga0228682_1048266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300023704|Ga0228684_1066162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
(restricted) 3300024261|Ga0233439_10232674Not Available824Open in IMG/M
3300024346|Ga0244775_10941166Not Available684Open in IMG/M
3300024346|Ga0244775_10960290Not Available676Open in IMG/M
3300025626|Ga0209716_1081499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium964Open in IMG/M
3300025890|Ga0209631_10239790Not Available909Open in IMG/M
3300025892|Ga0209630_10498578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300026398|Ga0247606_1022353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300026449|Ga0247593_1107403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300026461|Ga0247600_1082333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300026462|Ga0247568_1101238Not Available566Open in IMG/M
3300026465|Ga0247588_1093739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300027308|Ga0208796_1055246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum880Open in IMG/M
3300027833|Ga0209092_10452378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300027849|Ga0209712_10349860Not Available835Open in IMG/M
3300028137|Ga0256412_1223084Not Available696Open in IMG/M
3300028250|Ga0247560_114166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300028282|Ga0256413_1286091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300028334|Ga0247597_1058439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300030653|Ga0307402_10522079Not Available689Open in IMG/M
3300030671|Ga0307403_10552816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300030671|Ga0307403_10560249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300030671|Ga0307403_10570863Not Available613Open in IMG/M
3300030699|Ga0307398_10526038Not Available652Open in IMG/M
3300030721|Ga0308133_1041863Not Available618Open in IMG/M
3300031523|Ga0307492_10188280Not Available732Open in IMG/M
3300031523|Ga0307492_10203873Not Available706Open in IMG/M
3300031579|Ga0308134_1106187Not Available642Open in IMG/M
3300031725|Ga0307381_10197300Not Available703Open in IMG/M
3300031725|Ga0307381_10262457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300031725|Ga0307381_10276322Not Available601Open in IMG/M
3300031725|Ga0307381_10295990Not Available582Open in IMG/M
3300031725|Ga0307381_10299053Not Available579Open in IMG/M
3300031729|Ga0307391_10685290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300031734|Ga0307397_10381161Not Available649Open in IMG/M
3300031735|Ga0307394_10327658Not Available610Open in IMG/M
3300031739|Ga0307383_10475877Not Available620Open in IMG/M
3300031739|Ga0307383_10555858Not Available576Open in IMG/M
3300031739|Ga0307383_10593504Not Available558Open in IMG/M
3300031742|Ga0307395_10454111Not Available559Open in IMG/M
3300032481|Ga0314668_10403726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300032517|Ga0314688_10444241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300032518|Ga0314689_10245046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum934Open in IMG/M
3300032520|Ga0314667_10435630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300032615|Ga0314674_10308504Not Available823Open in IMG/M
3300032616|Ga0314671_10238719Not Available978Open in IMG/M
3300032707|Ga0314687_10425437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300032708|Ga0314669_10521750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300032709|Ga0314672_1212086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300032709|Ga0314672_1224001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300032714|Ga0314686_10634483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300032723|Ga0314703_10225953Not Available776Open in IMG/M
3300032723|Ga0314703_10454163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300032730|Ga0314699_10416729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300032734|Ga0314706_10337334Not Available730Open in IMG/M
3300032750|Ga0314708_10593440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300032752|Ga0314700_10311794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M
3300033572|Ga0307390_10756525Not Available611Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.34%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater11.64%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.59%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine7.53%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.16%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.48%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.42%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.74%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.37%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.37%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.37%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.37%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.68%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.68%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.68%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.68%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.68%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.68%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000368Marine microbial communities from Delaware Coast, sample from Delaware MO Late spring/early summerEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300003304Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI075_150m_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300018681Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026398Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028250Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 8R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010DRAFT_10220723300000368MarineMRSAIQDFATEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL*
BBAY94_1011253523300000949Macroalgal SurfaceMEKGDPHEGEPTGVFTLNEAQAKALGSAVLSTKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPAAYAPMLARFLANDQSLQL*
BBAY93_1010950223300000973Macroalgal SurfaceMRSVIQDFATEGEVMEKGDPHEGEPTGVFTLNEAQAKALGSAVLSTKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPAAYAPMLARFLANDQQLQL*
Ga0005273J48911_104641623300003304MarineMRSVIQDFSTEGENGDTHEPTGVFTLNEGQAKALGTAVLTTKKGLKGEELEGYLNDYWGKTWNHYDVNRSGSIPAGYAPMMVRFLANDNSL
Ga0008649_1033106413300005838MarineMRSVIQDFSTEGENGDTHEPTGVFTLNEGQAKALGTAVLTTKKGLKGEELEGYLNDYWGKTWNHYDVNRSGSIPAGYAPMMVRFLANDNSLML*
Ga0075494_102105323300006382AqueousMRSAIQDFATEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGY
Ga0075495_102251133300006399AqueousMRSAIQDFSTEGEFGKDSGKDANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL*
Ga0075496_149781633300006419AqueousMRSAIQDFSTEGEFGKDSGKDANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLA
Ga0075497_102119923300006424AqueousMRSAIQDFATEGEFGKDSGKLANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL*
Ga0075497_151652713300006424AqueousMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQSLQL*
Ga0102822_112879023300007558EstuarineMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGAAVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNSLMLN*
Ga0102823_108852513300007692EstuarineMFMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGAAVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNSLMLN*
Ga0102827_112613313300007715EstuarineMFMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGAAVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAITYSYAPMLVRFLANDNSLMLN*
Ga0103741_111926323300008938Ice Edge, Mcmurdo Sound, AntarcticaMRSVIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSSKKGLSGEALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL*
Ga0102813_110881513300009003EstuarineMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL*
Ga0102813_115488623300009003EstuarineMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGATVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNS
Ga0102813_128511513300009003EstuarineNFQTNADDQFMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSAVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQQLQL*
Ga0102905_114128113300009055EstuarineMRSAIQDFSTEGEFGKDSGKDKDGEDKEGKPNGVFTLNEAQAKALGSAVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPL
Ga0102814_1033644123300009079EstuarineMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGATVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNSLMLN*
Ga0103872_102624523300009263Surface Ocean WaterMRSVIQDFATEGEYPKDDPKEGEPNGVFTLNEAQAKALGSAVLSSKKGLTGAALDEYLGLYWAKTWRHYDVNQSGAIPVGYAPMLARFLAND*
Ga0115005_1081599313300009432MarineMRAAIQDFSTEGEVTDDGPTKGDPTGVFTLNEAQAKALGASVLSSKKGLTGEVLAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL*
Ga0115005_1082689513300009432MarineMRAAIQDFSTEGETKEGPTGVFTLNEAQAKALGSSVLSSKKGLAGEDLAEYLGNYWAKTWRHYDVNQSGAIPVGYAPMMVRFLANDNSLQL*
Ga0115005_1101459513300009432MarineMRSVIQDFSTEGETKEGPTGVFTLNEAQAKAVGSAVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGAIPVGYAPLMARFLANDQQLQL*
Ga0115008_1055928623300009436MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALSSAVLSTKKGLSGEALDEYLGLYWAKAWRHYDVNQAGSIPSAYAPMLARFIANDQSLQL*
Ga0115008_1091363613300009436MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALGSAVLSTRKGLSGEELAEYLGNYWAKTWRHYDVNQSGAIPSAYAPMLARFLANDQSLQL*
Ga0115007_1107294413300009441MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKAVGSAVLSTKKGLSGEDLAEYLGNYWAKTWRHYDVNQSGSIPVGYAPMMARFLANDQSLQL*
Ga0115569_1051954613300009497Pelagic MarineVIQDFSTEGEVTDDGPTKGDPTGVFTLNEAQAKAVGSAVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL*
Ga0115564_1029225823300009505Pelagic MarineMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL*
Ga0115572_1032044923300009507Pelagic MarineMRSAIQDFSTEGEFGKDSGKLANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL*
Ga0115103_188395413300009599MarineMRAAIQDFATEGEDKDTGPTGVFTLNEAQAKALGSSVLTSKKGLAGEELAEYLGNYWAKTWRHYDVNQSGSIPVGYAPMMVRFLANDNSLQL*
Ga0115104_1062733523300009677MarineMRSVIQDFATEGEYPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVLYAPSLARFLANDQSLML*
Ga0115104_1070643323300009677MarineMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQQLQL*
Ga0115104_1105176923300009677MarineMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLSTKKGLTGEALQEYLGLYWAKTWRHYDVNQSGSIPVGYAPMMVRFLANDNALQL*
Ga0115105_1119049813300009679MarineMRSVIQDFSTEGETKDGEPTGVFTLNEGQAKALGSKVLETKKGLKGEELEQYLADYWGKTWNHWDVNRTGSIPAAYAPMLVRFLANDQSVML*
Ga0138265_102109813300012408Polar MarineMRSVIQDFATEGEFGKDSGKNAAGEDKEGTPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLM
Ga0138266_138069113300012412Polar MarineMRSVIQDFATEGEFGKDSGKNAAGEDKEGTPTGVFTLNEAQAKALGSAVLSTKKGIAGADLAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL*
Ga0138264_161318513300012414Polar MarineMRSVIQDFATEGEHGKDSGKNAAGEDLEGTPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGNYWAKTWRHYDV
Ga0138263_125738723300012415Polar MarineMRSVIQDFATEGEFGKDSGKNAAGEDKEGTPTGVFTLNEAQAKALGSAVLSTKKGIAGADLAEYLGLYWAKTWRHYDVNQSGSIPVG
Ga0138263_164516613300012415Polar MarineMRSVIQDFATEGEHGKDSGKNAAGEDLEGTPTGVFTLNEAQAKALGSAVLSTKKGISGADLADYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL*
Ga0138259_111375113300012416Polar MarineMRAAIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSSKKGLSGEALAEYLGNYWAKTWRHYDVNQSGSIPVAYAPMLARFLANDQSLQL*
Ga0138259_141915413300012416Polar MarineMRSVIQDFSTEGEFPKDDPKEGEPTGTFTLNEAQAKALGSAVLSTKKGLSGEGLAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMAR
Ga0138262_187603023300012417Polar MarineMRSVIQDFSTEGEFPKDDPKEGEPTGTFTLNEAQAKALGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL*
Ga0138261_171446813300012418Polar MarineMRSVIQDFSTEGEFPKDDPKEGEPTGTFTLNEAQAKALGSAVLSTKKGLSGEALGEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL*
Ga0138267_115328523300012767Polar MarineMRSVIQDFATEGEHGKDSGKNAAGEDLEGTPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGNYWAKTWRHYDVNQSGSI
Ga0138267_124152713300012767Polar MarineMRSVIQDFATEGEFGKDSGKNAAGEDKEGTPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGNYWAKTWRHYDVNQSGSI
Ga0163180_1061188523300012952SeawaterMRSVIQDFATEGETKDGEPTGVFTLNEGQAKALGSAVLTTKKGLKGEELEAYLNDYWGKTWNHYDVNRTGSIPAGYAPMLVRFLANDMSVML*
Ga0193206_102063023300018681MarineMRSVIQDFATEGEDDDHNPTGVFTLNEGQAKALGSAVLKTKKGLDGADLEEYLGKYWGKTWNHYDVNRTGAIPAGYAPMMVRFLANDMSVML
Ga0192978_106582123300018871MarineMRSVIQDFSTEGEFPKDDPKEGEPTGTFTLNEAQAKALGSAVLSTKKGLSGEALGEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0192978_107514923300018871MarineMRAAIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSSKKGLSGEALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0192977_108891613300018874MarineMRSVIQDFATEGENKEGGNGVFTLNEAQAKALGSAVLSTKKNLTGPVLEEYLGAYWAKTWRHYDVNQSGSIPALYAPLLARFLANDQSLML
Ga0193090_110791313300018899MarineMRSVIQDFATEGENKEGGNGVFTLNEAQAKALGSAVLSTKKNLTGPVLEEYLGAYWAKTWRHYDVNQSGSIPALYAPLMARFLANDQSLQL
Ga0193353_1025128913300018977MarineMRSVIQDFSTEGETKDGEPTGVFTLNEGQAKALGSKVLETKKGLKGEELEQYLADYWGKTWNHWDVNRTGSIPAAYAPMLVRFLANDQSVML
Ga0192961_1014527813300018980MarineMRSVIQDFATEGEVTDKGPTEGNPTGVFTLNEAQAKALGSAVLSTKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPAGYAPLLARFLANDQSLQL
Ga0192961_1022616023300018980MarineMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSTKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0192982_1031241513300019021MarineMRSVIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGITGEALGEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0192951_1023610113300019022MarineMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQQLQL
Ga0192951_1035116313300019022MarineMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSTKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMMARFLANDQQLQL
Ga0192909_1015931813300019027MarineMRSVIQDFATEGEKDDDAHTPTGVFTLNEGQAKALGSAVLRTKKGLQDEELEEYLNSYWAKTWRHYDVNQSGSIPAGYAPMMVRFLANDMSLML
Ga0193516_1020736123300019031MarineMRSVIQDFATEGEADDDAHTPTGVFTLNEGQAKALGSAVLKTKKGLKDEELADYLDQYWAKTWRHFDVNQTGAIGVGFAPTMVRFLANDMSLML
Ga0193516_1025552213300019031MarineMRSVIQDFATEGETKDGEPTGVFTLNEGQAKALGSAVLTTKKGLKGEELEAYLNDYWGKTWNHYDVNRTGSIPAGYAPMLVRFLANDMSVML
Ga0193037_1027253013300019033MarineMRSVIQDFSTEGENKEGPTGVFTLNEGQAKALGSKVLETHKGLKGEELDEYLNNYWAKTWRHYDVNQSGSIPAGYAPMMVRFLANDMSLML
Ga0193037_1037337623300019033MarineMRSVIQDFSTEGENKDGPTGVFTLNEGQAKALGSKVLETHKGLKGEELDEYLNNYWAKTWRHYDVNQSGSIPAGYAPMMVRFLANDMSLML
Ga0193123_1040489123300019039MarineMRSVIQDFATEGEFPKDDPREGEPTGVFTLNEGQAKALGTAVLTTRKGLAGDELKDYLDAYWAKTWNHYDVNRTGSIPAAYAPMLARFLANDQWMQL
Ga0192981_1019859713300019048MarineMRSVIQDFSTEGEVGSGPKEGEPTGVFTLNEAQAKAVGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQSLQL
Ga0192981_1020029113300019048MarineMRSVIQDFATEGEFGKDSGKNAAGEDKEGTPTGVFTLNEAQAKALGSAVLSTKKGIAGADLAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0192981_1022434813300019048MarineLVQQKDFFPRDNGHAGYERKIPVNFQTNEDDIFMRSVIQDFATEGENKEGGNGVFTLNEAQAKALGSAVLSTKKNLTGPVLEEYLGAYWAKTWRHYDVNQSGSIPALYAPLMARFLANDQSLQL
Ga0192966_1019095213300019050MarineMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLSSKKELKGEALDEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQQLQL
Ga0182066_102183023300019262Salt MarshMFMRSVIQDFATEGEDKDHNPTGVFTLNEGQAKALGAAVLRTRKGLQGEELEEYLNQYWAKTWRHWDVNQSGSIPYSFAPMLVRFLANDNNLMLN
Ga0206687_137361613300021169SeawaterMRAAIQDFATEGEDKDTGPTGVFTLNEAQAKALGSSVLTSKKGLAGEELAEYLGNYWAKTWRHYDVNQSGSIPVGYAPMMVRFLANDNSLQL
Ga0206687_160653923300021169SeawaterMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQQLQL
Ga0206687_161914123300021169SeawaterMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0206687_166017923300021169SeawaterMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSAVLSTRKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPAGYAPMLARFLANDQSLQL
Ga0206692_167829923300021350SeawaterMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQQLQL
Ga0206689_1033916033300021359SeawaterMRSVIQDFSTEGETKDHEPTGVFTLNEGQAKALGSAVLTTKKGLKGEELDEYLNSYWVKTWNHYDVNRSGSIPAGYAPMMVRFLANDNSLML
Ga0206689_1055253423300021359SeawaterMRSVIQDFSTEGENKDGPTGVFTLNEGQAKALGSKVLETKKGLKGEELEEYLNSYWGKTWNHYDVNRGGSIPAGYAPMMVRFLANDNSLML
Ga0063089_103321023300021889MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALGSAVLSTRKGLSGEELAEYLGNYWAKTWRHYDVNQSGAIPSAYAPMLARFLANDQSLQL
Ga0063099_103556323300021894MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALGSAVLSTRKGLSGEELAEYLGNYWAKTWRHYDVNQSGAIPSAYAPMLARFLANDQSL
Ga0063087_106074123300021906MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALGSAVLSTRKGLSGEELAEYLGNYWAKTWRHYDVNQSGAIPSAYAPMLARFL
Ga0063104_102990523300021913MarineMRAAIQDFSTEGEVTDDGPTKGDGNGVFTLNEAQAKALGSSVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQSLQL
Ga0063102_100095523300021941MarineMRAAIQDFSTEGEVTDDGPTKGDPTGVFTLNEAQAKALGASVLSSKKGLTGEVLAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0063102_101117223300021941MarineMRAAIQDFSTEGETKEGPTGVFTLNEAQAKALGSSVLSSKKGLAGEDLAEYLGNYWAKTWRHYDVNQSGAIPVGYAPMMVRFLANDNSLQL
Ga0063098_106115323300021942MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALGSAVLSTRKGLSGEALAEYLGNYWAKTWRHYDVNQAGSIPSAYAPMLARFLAND
Ga0063098_106379823300021942MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALSSAVLSTKKGLSGEALDEYLGLYWAKAWRHYDVNQAGSIPSAYAPMLARFIANDQ
Ga0222716_1038349723300021959Estuarine WaterMFMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGAAVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNSLMLN
Ga0228679_103575823300023566SeawaterMRSVIQDFATEGEDKDTGPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQQLQL
Ga0228697_12017113300023674SeawaterMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGAAVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNSLMLN
Ga0232114_12007423300023676SeawaterMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGATVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNSLMLN
Ga0228682_104826623300023698SeawaterMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLA
Ga0228684_106616223300023704SeawaterMRSVIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSAVLSTRKGLTGEALAEYLGLYWANTWRHYDVNQSGSIPVGYAPMLARF
(restricted) Ga0233439_1023267423300024261SeawaterMRSVIQDFSTEGENGDTHEPTGVFTLNEGQAKALGTAVLTTKKGLKGEELEGYLNDYWGKTWNHYDVNRSGSIPAGYAPMMVRFLANDNSLML
Ga0244775_1094116623300024346EstuarineMFMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGATVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYAPMLVRFLANDNSLMLN
Ga0244775_1096029023300024346EstuarineMFMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGAAVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSY
Ga0209716_108149923300025626Pelagic MarineMRSAIQDFATEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0209631_1023979023300025890Pelagic MarineMRSVIQDFATEGEVTEKGDHEGEPTGVFTLNEAQAKALGSAVLSTKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPAGYAPLLARFLANDQSLQL
Ga0209630_1049857813300025892Pelagic MarineKIPVNFQTNADDQFMRSVIQDFSTEGEVTDDGPTKGDPTGVFTLNEAQAKAVGSAVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0247606_102235313300026398SeawaterMRSVIQDFATEGEDKDTGPTGVFTLNEAQAKALGSAVLSTRKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPAGYAPMLARFLANDQQLQL
Ga0247593_110740313300026449SeawaterMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLSTKKGLTGEALQEYLGLYWAKTWRHYDVNQSGSIPVGYAPMMVRFLANDNALQL
Ga0247600_108233323300026461SeawaterMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQQLQL
Ga0247568_110123823300026462SeawaterMRSVIQDFSTEGEDKDGNPTGVFTLNEGQAKALGAAVLRTRKGITGEELDDYLSQYWAKTWRHWDVNQAGAIPYSYA
Ga0247588_109373923300026465SeawaterMRSVIQDFATEGEDKDTGPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALQEYLGLYWAKTWRHYDVNQSGSIPVGYA
Ga0208796_105524613300027308EstuarineMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0209092_1045237813300027833MarineMRSVIQDFSTEGETKEGEPTGVFTLNEAQAKALSSAVLSTKKGLSGEALDEYLGLYWAKAWRHYDVNQAGSIPSAYAPMLARFIANDQSLQL
Ga0209712_1034986023300027849MarineMRSVIQDFSTEGETKEGPTGVFTLNEAQAKAVGSAVLSSKKGLSGEALAEYLGLYWAKTWRHYDVNQSGAIPVGYAPLMARFLANDQQLQL
Ga0256412_122308413300028137SeawaterMRSAIQDFATEGEYPKDDPKEGEPNGVFTLNEAQAKALGSAVLSSKKGLTAEALDEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0247560_11416623300028250SeawaterMRSVIQDFATEGEDKDTGPTGVFTLNEAQAKAVGSAVLSTKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLAN
Ga0256413_128609123300028282SeawaterMRSVIQDFATEGEYPKDDPKEGGPTGVFTLNEAQAKALGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGSIPAAYAPMLARFLANDQALQL
Ga0247597_105843913300028334SeawaterMRSVIHDFSTEGEDKDTGPTGVFTLNEAQAKALGSAVLSTRKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPAGYAPMLARFLANDQSLQL
Ga0307402_1052207923300030653MarineMRSVIQDFATEGEFGKDSGKNAAGEDKEGTPTGVFTLNEAQAKALGSAVLSTKKGIAGADLAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0307403_1055281623300030671MarineMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLSSKKELKGEALEEYLGLYWAKTWRHYDVNQSGSIPVGYAPMMVRFLANDNSLQL
Ga0307403_1056024923300030671MarineMRSVIQDFSTEGEFPKDDPKEGEPTGTFTLNEAQAKALGSAVLSTKKGLSGEALGEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQQ
Ga0307403_1057086323300030671MarineMRAAIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSSKKGLSGEALAEYLGNYWAKTWRHYDVNQSGSIPVGDAPMLARFLANDQSLQL
Ga0307398_1052603823300030699MarineMRAAIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSSKKGLSGEALAQYLGNYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0308133_104186313300030721MarineMRSVIQDFSTEGETKENEPTGVFTLNEAQAKALGSAVLSTKKGLSGEDLAEYLGNYWAKTWRHYDVNQSGSIPALYAPSLARFLANDQSLQL
Ga0307492_1018828013300031523Sea-Ice BrineMRSVIQDFATEGEFPKDDPKEGEPTGVFTLNEAQAKAVGSAVLTTKKGLAGPALAEYLNNYWAKTWRHYNVNETGSIPVLYAPLLARFLANDQSLQL
Ga0307492_1020387313300031523Sea-Ice BrineMRSVIQDFATEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGLTGPALAEYLNNYWAKTWRHYNVNETGSIPVLYAPLLARFLANDQ
Ga0308134_110618723300031579MarineMRSVIQDFSTEGETKDGEPTGVFTLNEAQAKALGSAVLSTKKGLAAEDLAEYLGNYWAKTWRHYDVNQSGSIPALYAPSLARFLANDQSLQL
Ga0307381_1019730023300031725MarineMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLTSKKGLAGEDLAEYLGNYWAKTWRHYDVNQSGSIPVGYAPMMVRFLANDNSLQL
Ga0307381_1026245713300031725MarineMRSVIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGLSGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0307381_1027632223300031725MarineMRSVIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSLQL
Ga0307381_1029599023300031725MarineMRAAIQDFSTEGEFPKDDPKEGEPNGVFTLNEAQAKALGSAVLSSKKGLSGEGLAEYLGLYWAKTWRHYDVNQAGSIPVAYAPMLARFLA
Ga0307381_1029905323300031725MarineMRSVIQDFSTEGEFTKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGSIPVGY
Ga0307391_1068529013300031729MarineMRAAIQDFSTEGEDKDTGPTGVFTLNEAQAKALGSSVLTSKKGLAGPELEEYLGAYWAKTWRHYDVNQAGSIPVGYAPMMV
Ga0307397_1038116113300031734MarineMRSVIQDFATEGEFGKDSGKNAAGEDKEGTPTGVFTLNEAQAKALGSAVLSTKKGIAGADLAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQSL
Ga0307394_1032765823300031735MarineMRSVIQDFSTEGEVGSGPKEGEPTGVFTLNEAQAKALGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQSLQL
Ga0307383_1047587713300031739MarineMRAAIQDFSTEGEFPKDDPKEGEPNGVFTLNEAQAKALGSAVLSSKKGLSGEGLAEYLGLYWAKTWRHYDVNQAGSIPVAYAPMLARFLANDQSLQL
Ga0307383_1055585813300031739MarineMRSVIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGS
Ga0307383_1059350423300031739MarineMRSVIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSTKKGITGEALAEYLGLYWAKTWRHYDVNQSGSIPVG
Ga0307395_1045411123300031742MarineMRAAIQDFSTEGEFPKDDPKEGEPTGVFTLNEAQAKALGSAVLSSKKGLSGEALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPMLARFLANDQSL
Ga0314668_1040372613300032481SeawaterMRSAIQDFSTEGEFGKDSGKLANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLLA
Ga0314688_1044424133300032517SeawaterMRSAIQDFSTEGEFGKDSGKDANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSL
Ga0314689_1024504613300032518SeawaterMRSAIQDFSTEGEFGKDSGKDANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0314667_1043563013300032520SeawaterMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQ
Ga0314674_1030850413300032615SeawaterMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0314671_1023871913300032616SeawaterMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQSLQL
Ga0314687_1042543713300032707SeawaterMRSAIQDFATEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAP
Ga0314669_1052175013300032708SeawaterMRSAIQDFATEGEFGKDSGKLANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0314672_121208623300032709SeawaterMRSAIQDFSTEGEFGKDSGKLANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0314672_122400133300032709SeawaterMRSAIQDFSTEGEFGKDSGKDANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFL
Ga0314686_1063448313300032714SeawaterMRSAIQDFSTEGEFGKDSGKDANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAP
Ga0314703_1022595313300032723SeawaterMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVN
Ga0314703_1045416313300032723SeawaterMRSAIQDFSTEGEFGKDSGKLANGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGEALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0314699_1041672933300032730SeawaterMRSAIQDFSTEGEFGKDSGKDANGGDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSLQL
Ga0314706_1033733423300032734SeawaterMRSAIQDFATEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLLARFLANDQSLQL
Ga0314708_1059344023300032750SeawaterMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGLYWAKTWRHYDVNQSGSIPVGYAPLMARFLANDQSL
Ga0314700_1031179413300032752SeawaterMRSAIQDFSTEGEFGKDSGKNAEGEDKEGTPNGVFTLNEAQAKALGSAVLSSKKGLTGDALAEYLGNYWAKTWRHYDVNQSGSIPVGYAPLLARF
Ga0307390_1075652523300033572MarineMRSVIQDFATEGENKEGGNGVFTLNEAQAKALGSAVLSTKKNLTGPVLEEYLGAYWAKTWRHYDVNQSGSIPALYAPLMARFLANDQSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.