Basic Information | |
---|---|
Taxon OID | 3300012284 Open in IMG/M |
Scaffold ID | Ga0116696_1131979 Open in IMG/M |
Source Dataset Name | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 523 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand → Beach Sand Microbial Communities From Municipal Pensacola Beach, Florida |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Municipal Pensacola Beach, FL | |||||||
Coordinates | Lat. (o) | 30.3262 | Long. (o) | -87.1745 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006866 | Metagenome / Metatranscriptome | 363 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116696_11319792 | F006866 | N/A | MSDNGKSANVLINRNNLNNIFELLVQIHLRGQLSRDEQAFIKNFIELPEAPTRENRQARRANTQAIKKLFREEAKKR |
⦗Top⦘ |