Scaffold Ga0137388_10751033

Overview

Basic Information

• Taxon OID: 3300012189
• Scaffold ID: Ga0137388_10751033
• Source Dataset Name: Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 905
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 39.7291
  • Long. (^o): -123.6419

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078446	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137388_107510332	F078446	N/A	MLTYSTLQDRPREFLAATGLTHDEFARVLPAFAAASAVLSPPDKT