Scaffold Ga0153990_1030124

Overview

Basic Information

• Taxon OID: 3300012169
• Scaffold ID: Ga0153990_1030124
• Source Dataset Name: Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1231
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: North Carolina, Jones Lake State Park
• Coordinates
  • Lat. (^o): 34.5815
  • Long. (^o): -78.4487

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046519	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153990_10301241	F046519	GGA	MEEQCVTSGGLTQSPEGTGVSEPISASEMVSEAASVIGRPHSTSSAVKAA