Scaffold Ga0154005_103570

Overview

Basic Information

• Taxon OID: 3300012061
• Scaffold ID: Ga0154005_103570
• Source Dataset Name: Attine ant fungus gardens microbial communities from Florida, USA - TSFL089 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1749
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Florida, Lake Talquin State Forest
• Coordinates
  • Lat. (^o): 30.4649
  • Long. (^o): -84.3641

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061597	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0154005_1035701	F061597	N/A	IYFNFGFVDCRNCKTLDKLTDQPGTLIPLDRGGVPDLSVSGNKFDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTNLAAARSA*