| Basic Information | |
|---|---|
| Taxon OID | 3300012061 Open in IMG/M |
| Scaffold ID | Ga0154005_100983 Open in IMG/M |
| Source Dataset Name | Attine ant fungus gardens microbial communities from Florida, USA - TSFL089 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8389 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Florida, Lake Talquin State Forest | |||||||
| Coordinates | Lat. (o) | 30.4649 | Long. (o) | -84.3641 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000950 | Metagenome | 822 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0154005_1009831 | F000950 | N/A | NKNQLFRAQLMKLLEEDNDNSESPPEVVNVNSASIEEIPDPLPLSGKGKGTPKLDFPLGL |
| ⦗Top⦘ |