| Basic Information | |
|---|---|
| Taxon OID | 3300011975 Open in IMG/M |
| Scaffold ID | Ga0156901_1096516 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Norwegian Young Sea Ice, Arctic Ocean, Norway, 2015. Combined Assembly of 9 SPs correct ver. |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | LGC Genomics |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3122 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (12.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Norwegian Young Sea Ice 2015 - N-Ice15 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 83.166667 | Long. (o) | 22.016944 | Alt. (m) | Depth (m) | 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021649 | Metagenome / Metatranscriptome | 218 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0156901_10965166 | F021649 | N/A | XXXXGVFYDLMTTEEIDFGIHELFPTDCVHSFLGWAKNAEGTDVEPDELITE* |
| ⦗Top⦘ |