x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300011975
3300011975: Seawater microbial communities from Norwegian Young Sea Ice, Arctic Ocean, Norway, 2015. Combined Assembly of 9 SPs correct ver.
Overview
| Basic Information |
| IMG/M Taxon OID | 3300011975 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0121717 | Gp0173404 | Ga0156901 |
| Sample Name | Seawater microbial communities from Norwegian Young Sea Ice, Arctic Ocean, Norway, 2015. Combined Assembly of 9 SPs correct ver. |
| Sequencing Status | Permanent Draft |
| Sequencing Center | LGC Genomics |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 11493767 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → Viruses → Predicted Viral | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Norwegian Young Sea Ice 2015 - N-Ice15 |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Norwegian Young Sea Ice 2015 - N-Ice15 |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information |
| Location | Arctic Ocean |
| Coordinates | Lat. (o) | 83.166667 | Long. (o) | 22.016944 | Alt. (m) | N/A | Depth (m) | 50 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F021649 | Metagenome / Metatranscriptome | 218 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0156901_1096516 | Ga0156901_10965166 | F021649 | XXXXGVFYDLMTTEEIDFGIHELFPTDCVHSFLGWAKNAEGTDVEPDELITE* |
