Scaffold Ga0119794_1039040

Overview

Basic Information

• Taxon OID: 3300011970
• Scaffold ID: Ga0119794_1039040
• Source Dataset Name: Human oral microbial communities from Los Angeles, CA, USA - S12-02-D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Los Angeles
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 574
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location

• Location Name: USA: Los Angeles
• Coordinates
  • Lat. (^o): 34.0722
  • Long. (^o): -118.4441

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051213	Metagenome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119794_10390401	F051213	N/A	FVFTSCDWVGNEPTIEGDIDKYFDSNAQRKSFRVVNASGKRYNHKVDWHIVGITQLGLKTYLTEKVDTLSNGDLKISYDWVSFTVKENKSVIEVEVQKNETGKDRSVLFATRNDDKQAHLPDMIVTQGGK*