Scaffold Ga0120681_1005916

Overview

Basic Information

• Taxon OID: 3300011968
• Scaffold ID: Ga0120681_1005916
• Source Dataset Name: Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-06
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Weill Cornell Medical College
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 632
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG22_combo_CG10-13_8_21_14_all_63_91 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location

• Location Name: USA:New York City
• Coordinates
  • Lat. (^o): 40.67
  • Long. (^o): -73.99

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092080	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120681_10059161	F092080	N/A	MCIYIPYKGGKGMQDKRVTIRIPFEIWKALRELQTVGKISSIQQAAVTGMNKLIESLKWGEEDNQRGAAKKRVLNVLVKEKPLGNWEDIHRERTESDVDRS*