Scaffold Ga0119875_112801

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119875_112801

Scaffold Ga0119875_112801

Overview

Basic Information
Taxon OID	3300011965 Open in IMG/M
Scaffold ID	Ga0119875_112801 Open in IMG/M
Source Dataset Name	Anaerobic sludge microbial communities from wastewater treatment plant in Hong Kong, China - Thermophilic cellulolytic sludge
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hong Kong
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	778
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Thermophilic Cellulolytic Sludge → Anaerobic Sludge Microbial Communities From Wastewater Treatment Plant In Hong Kong, China

Source Dataset Sampling Location
Location Name	Hong Kong
Coordinates	Lat. (^o)	22.3	Long. (^o)	114.1	Alt. (m)		Depth (m)	.05
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046219	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119875_1128012	F046219	AGGCGG	LLRRAIDLRAALKMGIRISLDEIRADEFRALVVLEEERDALDREQMN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.