Scaffold Ga0119875_104311

Overview

Basic Information

• Taxon OID: 3300011965
• Scaffold ID: Ga0119875_104311
• Source Dataset Name: Anaerobic sludge microbial communities from wastewater treatment plant in Hong Kong, China - Thermophilic cellulolytic sludge
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hong Kong
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1960
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Thermophilic Cellulolytic Sludge → Anaerobic Sludge Microbial Communities From Wastewater Treatment Plant In Hong Kong, China

Source Dataset Sampling Location

• Location Name: Hong Kong
• Coordinates
  • Lat. (^o): 22.3
  • Long. (^o): 114.1
  • Depth (m): .05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001564	Metagenome / Metatranscriptome	670	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119875_1043112	F001564	N/A	LIHWALRRDELCDPGLCPDAPDDGGRCGHCPLDKLDAAQSSEAGLLFRRALDFRAALKLGIRISLDDIRADEFRALVVLEEERDALDREQMNAHGR*