NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119875_100141

Scaffold Ga0119875_100141


Overview

Basic Information
Taxon OID3300011965 Open in IMG/M
Scaffold IDGa0119875_100141 Open in IMG/M
Source Dataset NameAnaerobic sludge microbial communities from wastewater treatment plant in Hong Kong, China - Thermophilic cellulolytic sludge
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hong Kong
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32780
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (12.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Thermophilic Cellulolytic Sludge → Anaerobic Sludge Microbial Communities From Wastewater Treatment Plant In Hong Kong, China

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.3Long. (o)114.1Alt. (m)Depth (m).05
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065696Metagenome / Metatranscriptome127Y
F090436Metagenome / Metatranscriptome108N
F101220Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0119875_10014114F065696N/AMKKVIYILLILFLISCSKQQPIKYLGDREPSPLHYIDDLDIKLYAICSKHQALHLYQDVKGTIIQEIGINNYYSTMQHRMSIISYTNDIGTCQFQSATYDWLSDKYGINTNKIDPEYSQIEVMVLAFLDNRQELWVGFKKFNSFKNNIHIYKI*
Ga0119875_10014115F090436N/AMKTQKNTPEVKSKVTFENFFLNTFANFEKISSDERKMLKNTNPNFISKSGSIYWYLTGYVYRYSSHFSRDTKTCAWFLEGKSVTNNVSGNYGKCKLEDFVQINTNAEIGKKYKIIYAPRDRRGVAFITEGEGVLQKTTEFYYIFDTFKVHKWTLVTLIEK*
Ga0119875_10014116F101220N/AMKTKKLKNFIKKNYSKELVLNAYEFYADPPSYFLEYLQSQEQDYDYILDVFLEECRNNNVSISDAINYYIKNKKEEYECR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.