| Basic Information | |
|---|---|
| Taxon OID | 3300011933 Open in IMG/M |
| Scaffold ID | Ga0119782_100028 Open in IMG/M |
| Source Dataset Name | Human subgingival plaque microbial communities from Los Angeles, CA, USA - S03-03-R |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Los Angeles |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 96199 |
| Total Scaffold Genes | 120 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 73 (60.83%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Subgingival Plaque → Human Oral Microbial Communities From Los Angeles, Ca, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Los Angeles | |||||||
| Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076191 | Metagenome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119782_10002889 | F076191 | AGGA | MKIIAENPAEEALLWRIKALSDELVNQDNRCTNMPVWTILDNNKAGKDYGAVMYFTGKAAEQHIEENDNYYDNPTTYIRSAHDNRELKDVIHLLILAGGNEIPSNHYGILRDA* |
| ⦗Top⦘ |