Scaffold Ga0121110_100002

Overview

Basic Information

• Taxon OID: 3300011875
• Scaffold ID: Ga0121110_100002
• Source Dataset Name: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00892
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Weill Cornell Medical College
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1220415
• Total Scaffold Genes: 1084
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 641 (59.13%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. B-9 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location

• Location Name: USA:New York City
• Coordinates
  • Lat. (^o): 40.74
  • Long. (^o): -73.89

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036230	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0121110_100002164	F036230	AGGAGG	MIQVNDIVQVKPDREAFGACMVVVTEVKSWGIQGYVQSAGVDGQQYIRLKSGDFEPTGGKAVWVAP*