3300011875: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00892

Overview

Basic Information

• IMG/M Taxon OID: 3300011875
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118444 | Gp0135342 | Ga0121110
• Sample Name: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00892
• Sequencing Status: Permanent Draft
• Sequencing Center: Weill Cornell Medical College
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 46117136
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. B-9	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
• Type: Engineered
• Taxonomy: Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA:New York City
• Coordinates
  • Lat. (^o): 40.74
  • Long. (^o): -73.89
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036230	Metagenome / Metatranscriptome	170	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0121110_100002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. B-9	1220415

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0121110_100002	Ga0121110_100002164	F036230	MIQVNDIVQVKPDREAFGACMVVVTEVKSWGIQGYVQSAGVDGQQYIRLKSGDFEPTGGKAVWVAP*