Scaffold Ga0122010_112685

Overview

Basic Information

• Taxon OID: 3300011722
• Scaffold ID: Ga0122010_112685
• Source Dataset Name: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway plastic -P00359
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Weill Cornell Medical College
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 568
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → City → Subway → Unclassified → City Subway Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location

• Location Name: USA:New York City
• Coordinates
  • Lat. (^o): 40.55
  • Long. (^o): -74.13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028713	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0122010_1126851	F028713	GAGG	MIEEKKVLLVKVDTLKNIADALTKSVSSKKFSWCRETMCIAGLDK*