3300011722: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway plastic -P00359

Overview

Basic Information

• IMG/M Taxon OID: 3300011722
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118444 | Gp0135964 | Ga0122010
• Sample Name: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway plastic -P00359
• Sequencing Status: Permanent Draft
• Sequencing Center: Weill Cornell Medical College
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 32474956
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
• Type: Engineered
• Taxonomy: Engineered → Built Environment → City → Subway → Unclassified → City Subway Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA:New York City
• Coordinates
  • Lat. (^o): 40.55
  • Long. (^o): -74.13
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028713	Metagenome / Metatranscriptome	190	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0122010_112685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca	568

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0122010_112685	Ga0122010_1126851	F028713	MIEEKKVLLVKVDTLKNIADALTKSVSSKKFSWCRETMCIAGLDK*