| Basic Information | |
|---|---|
| Taxon OID | 3300011664 Open in IMG/M |
| Scaffold ID | Ga0120344_106549 Open in IMG/M |
| Source Dataset Name | Fossil microbial communities from tooth of medieval black death victim, London UK - 8291 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McMaster University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 670 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossill → Fossil Microbial Communities From Human Samples From Several Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UK: London | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062732 | Metagenome / Metatranscriptome | 130 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120344_1065491 | F062732 | GAG | VSQIDMTLRPSWESDAEFARNWQDYLQRAGVVDSQIRQQLVMQIPAGPNYVVVAWVMDLKAPVLNPAAPTFAIAPVQAKTMEARMLATVDAQRRVIEHFDAAAISEGVPRGQELWFLIDPDGKVLRAGRRTTITNPQAARLAMQKMFPEISVSYVTRGTPVKDAAGKRVPVSWQWLEKTEAGTAQR* |
| ⦗Top⦘ |