Scaffold Ga0120344_104547

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120344_104547

Scaffold Ga0120344_104547

Overview

Basic Information
Taxon OID	3300011664 Open in IMG/M
Scaffold ID	Ga0120344_104547 Open in IMG/M
Source Dataset Name	Fossil microbial communities from tooth of medieval black death victim, London UK - 8291
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McMaster University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	824
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossill → Fossil Microbial Communities From Human Samples From Several Locations

Source Dataset Sampling Location
Location Name	UK: London
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082758	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120344_1045471	F082758	N/A	VYVDVNVMRNDKASPGPFYLGYRDWECDTDCVPAAFEASAKELSAMIRYMLELGPAAQTHTVPVAWQSKPLVTSVDKWANTCATKVDKDRVVREYGERFWLNDPSSRTLLSAAWRGCNIFANR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.