Scaffold Ga0120177_102857

Overview

Basic Information

• Taxon OID: 3300011557
• Scaffold ID: Ga0120177_102857
• Source Dataset Name: Permafrost microbial communities from the Kolyma-Indigirka Lowland, Siberia, Russia - IC8_1M_join_R1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Institute of Physicochemical and Biological Problems in Soil Science
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From The Kolyma-Indigirka Lowland, Siberia, Russia

Source Dataset Sampling Location

• Location Name: Russia: Siberia
• Coordinates
  • Lat. (^o): 68.716667
  • Long. (^o): 158.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056720	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120177_1028571	F056720	GGA	MNFAPRMPTIIVALVLVLIGLLGTFGGMLPSVAGMSSETLGAWSFVVA