3300011557: Permafrost microbial communities from the Kolyma-Indigirka Lowland, Siberia, Russia - IC8_1M_join_R1

Overview

Basic Information

• IMG/M Taxon OID: 3300011557
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114369 | Gp0137591 | Ga0120177
• Sample Name: Permafrost microbial communities from the Kolyma-Indigirka Lowland, Siberia, Russia - IC8_1M_join_R1
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute of Physicochemical and Biological Problems in Soil Science
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 11064975
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Permafrost Microbial Communities From The Kolyma-Indigirka Lowland, Siberia, Russia
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From The Kolyma-Indigirka Lowland, Siberia, Russia

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): polar biome → polar → permafrost
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Russia: Siberia
• Coordinates
  • Lat. (^o): 68.716667
  • Long. (^o): 158.9
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056720	Metagenome	137	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0120177_102857	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	538

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120177_102857	Ga0120177_1028571	F056720	MNFAPRMPTIIVALVLVLIGLLGTFGGMLPSVAGMSSETLGAWSFVVA