NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137426_1046186

Scaffold Ga0137426_1046186


Overview

Basic Information
Taxon OID3300011435 Open in IMG/M
Scaffold IDGa0137426_1046186 Open in IMG/M
Source Dataset NameSoil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1132
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8893Long. (o)-106.9078Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004237Metagenome / Metatranscriptome447Y
F103461Metagenome101N

Sequences

Protein IDFamilyRBSSequence
Ga0137426_10461861F103461AGGAGGMFRRPETKATEEKVYKQERIGEFMTTWKDFPRPGLAAWAERKKAGLMGTAKSTYYTPR
Ga0137426_10461862F004237N/AVPQQVLEAMHASDVVIWVWPVFITFTPAHRAMGRKREESGTQLHENRMKPYHIYFEGNAGLLARDYAKFPNKVLWKLAEKVREVVAAGKVVRMEDSLGTSLTATYDGKRLYGMQFRAGDPPGRCHFPWGRCGVFNGDGEANGEVYLSCVQGVAGMLREPMRWKVKDSLITEVDGGGEIGEECKRLFKEVPESNRLIEIMFGYHPKASAEYGIADPLHWELISKMPWAGLGTPRKHPKFRHMDGSVFNGRLYIDDRLVVDRHGMLDRSLLHHPEVLEAAAEFGDPYTVLAPVSHEAHGSGTLW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.