Scaffold Ga0137325_1000147

Overview

Basic Information

• Taxon OID: 3300011415
• Scaffold ID: Ga0137325_1000147
• Source Dataset Name: Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16067
• Total Scaffold Genes: 25
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium caraganae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.8893
  • Long. (^o): -106.908
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061881	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137325_10001477	F061881	AGGAG	MLSRDGRQERKLKAIRWAQFRLKQRLEAIDFMEDVLGPEVEALKSGKSVLGLAEGMAFDIKVVDHADSDHPQTDDAE*