Scaffold Ga0138396_114914

Overview

Basic Information

• Taxon OID: 3300011289
• Scaffold ID: Ga0138396_114914
• Source Dataset Name: Marine microbial communities from the Southern Atlantic ocean - KN S19 O2min_A metaT (Metagenome Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 640
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic Ocean
• Coordinates
  • Lat. (^o): -28.2362
  • Long. (^o): -38.4949

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076161	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0138396_1149141	F076161	N/A	NFSSRRPKTGFRAFAEKPAVKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIAADPKERSNLLSSPTNPDAPTGKPV*