| Basic Information | |
|---|---|
| Taxon OID | 3300011273 Open in IMG/M |
| Scaffold ID | Ga0138352_108486 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Deep Pacific Ocean - MP1492 (Metagenome Metatranscriptome) (version 2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 767 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -25.2939 | Long. (o) | -179.3141 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076161 | Metagenome / Metatranscriptome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138352_1084861 | F076161 | N/A | MKSINFSSRCPKTGFRAFAEKPAAKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIATNPKERSNLLSSPTNPDAPTGKPI* |
| ⦗Top⦘ |