Basic Information | |
---|---|
Taxon OID | 3300011268 Open in IMG/M |
Scaffold ID | Ga0151620_1154801 Open in IMG/M |
Source Dataset Name | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 703 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → The Molecular Ecology Of Microcystis Sp. Blooms In The San Francisco Estuary Delta |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | San Francisco Estuary Delta, California, USA | |||||||
Coordinates | Lat. (o) | 37.986944 | Long. (o) | -121.523611 | Alt. (m) | Depth (m) | .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019319 | Metagenome | 230 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0151620_11548013 | F019319 | N/A | QDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK* |
⦗Top⦘ |