Basic Information | |
---|---|
Family ID | F019319 |
Family Type | Metagenome |
Number of Sequences | 230 |
Average Sequence Length | 43 residues |
Representative Sequence | MTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKK |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 230 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 57.39 % |
% of genes near scaffold ends (potentially truncated) | 46.52 % |
% of genes from short scaffolds (< 2000 bps) | 83.48 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (43.043 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (26.956 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.739 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.435 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 79.07% β-sheet: 0.00% Coil/Unstructured: 20.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 230 Family Scaffolds |
---|---|---|
PF13481 | AAA_25 | 3.48 |
PF01555 | N6_N4_Mtase | 3.04 |
PF12705 | PDDEXK_1 | 3.04 |
PF00145 | DNA_methylase | 1.30 |
PF09250 | Prim-Pol | 0.87 |
PF00535 | Glycos_transf_2 | 0.43 |
PF02557 | VanY | 0.43 |
PF00534 | Glycos_transf_1 | 0.43 |
PF05065 | Phage_capsid | 0.43 |
PF07691 | PA14 | 0.43 |
PF13649 | Methyltransf_25 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
---|---|---|---|
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.04 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.04 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.04 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.30 |
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.65 % |
Unclassified | root | N/A | 34.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002835|B570J40625_100217935 | All Organisms → Viruses → Predicted Viral | 2039 | Open in IMG/M |
3300003277|JGI25908J49247_10004831 | All Organisms → Viruses → Predicted Viral | 4317 | Open in IMG/M |
3300003277|JGI25908J49247_10104113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300003393|JGI25909J50240_1050215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300003394|JGI25907J50239_1010177 | All Organisms → Viruses → Predicted Viral | 2211 | Open in IMG/M |
3300003431|JGI25913J50563_1045554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300004240|Ga0007787_10151916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
3300004240|Ga0007787_10398074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300005581|Ga0049081_10075492 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
3300005581|Ga0049081_10110728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
3300005581|Ga0049081_10189553 | Not Available | 740 | Open in IMG/M |
3300005581|Ga0049081_10281589 | Not Available | 576 | Open in IMG/M |
3300005581|Ga0049081_10287045 | Not Available | 569 | Open in IMG/M |
3300005582|Ga0049080_10074400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300005582|Ga0049080_10290305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300005805|Ga0079957_1107720 | All Organisms → Viruses → Predicted Viral | 1503 | Open in IMG/M |
3300005805|Ga0079957_1123622 | Not Available | 1363 | Open in IMG/M |
3300005805|Ga0079957_1139469 | Not Available | 1250 | Open in IMG/M |
3300005805|Ga0079957_1163712 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
3300005805|Ga0079957_1202214 | Not Available | 957 | Open in IMG/M |
3300005805|Ga0079957_1219244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300005805|Ga0079957_1223752 | Not Available | 891 | Open in IMG/M |
3300005805|Ga0079957_1288417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300006484|Ga0070744_10122936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300006484|Ga0070744_10132937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300006484|Ga0070744_10220630 | Not Available | 538 | Open in IMG/M |
3300006802|Ga0070749_10134063 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
3300006802|Ga0070749_10533204 | Not Available | 637 | Open in IMG/M |
3300006805|Ga0075464_10058982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2139 | Open in IMG/M |
3300006805|Ga0075464_10182273 | All Organisms → Viruses → Predicted Viral | 1243 | Open in IMG/M |
3300006805|Ga0075464_10360976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300006805|Ga0075464_10597341 | Not Available | 679 | Open in IMG/M |
3300006805|Ga0075464_10668895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300006805|Ga0075464_11084807 | Not Available | 504 | Open in IMG/M |
3300006916|Ga0070750_10212624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300006920|Ga0070748_1032203 | All Organisms → Viruses → Predicted Viral | 2147 | Open in IMG/M |
3300007229|Ga0075468_10250748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300007344|Ga0070745_1088519 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
3300007363|Ga0075458_10028548 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
3300007363|Ga0075458_10247122 | Not Available | 544 | Open in IMG/M |
3300007542|Ga0099846_1339994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300007559|Ga0102828_1021375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
3300007559|Ga0102828_1126296 | Not Available | 633 | Open in IMG/M |
3300007559|Ga0102828_1146248 | Not Available | 591 | Open in IMG/M |
3300007708|Ga0102859_1098722 | Not Available | 839 | Open in IMG/M |
3300007708|Ga0102859_1215568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300007734|Ga0104986_1265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12860 | Open in IMG/M |
3300007735|Ga0104988_10823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32140 | Open in IMG/M |
3300007972|Ga0105745_1170042 | Not Available | 675 | Open in IMG/M |
3300008055|Ga0108970_10318342 | Not Available | 699 | Open in IMG/M |
3300008450|Ga0114880_1225221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300009026|Ga0102829_1120411 | Not Available | 828 | Open in IMG/M |
3300009039|Ga0105152_10034346 | All Organisms → Viruses → Predicted Viral | 2009 | Open in IMG/M |
3300009056|Ga0102860_1025397 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
3300009160|Ga0114981_10784754 | Not Available | 502 | Open in IMG/M |
3300009161|Ga0114966_10297518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300009164|Ga0114975_10198274 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
3300009183|Ga0114974_10103947 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
3300009183|Ga0114974_10400763 | Not Available | 785 | Open in IMG/M |
3300009183|Ga0114974_10407655 | Not Available | 777 | Open in IMG/M |
3300009184|Ga0114976_10275278 | Not Available | 906 | Open in IMG/M |
3300009185|Ga0114971_10150237 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
3300009185|Ga0114971_10480077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300010293|Ga0116204_1124572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300010370|Ga0129336_10765711 | Not Available | 509 | Open in IMG/M |
3300010885|Ga0133913_10056528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10534 | Open in IMG/M |
3300010885|Ga0133913_13538686 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
3300011115|Ga0151514_10409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18886 | Open in IMG/M |
3300011116|Ga0151516_10644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16277 | Open in IMG/M |
3300011268|Ga0151620_1154801 | Not Available | 703 | Open in IMG/M |
3300011337|Ga0153702_1752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10262 | Open in IMG/M |
3300011995|Ga0153800_1018457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300011995|Ga0153800_1023604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300012006|Ga0119955_1112464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300012013|Ga0153805_1025888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300013006|Ga0164294_11088259 | Not Available | 536 | Open in IMG/M |
3300013014|Ga0164295_10728819 | Not Available | 766 | Open in IMG/M |
3300013087|Ga0163212_1018279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2559 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1028310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2480 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1115690 | Not Available | 1012 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10410851 | Not Available | 764 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10412452 | Not Available | 762 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10569444 | Not Available | 612 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10607004 | Not Available | 587 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10687205 | Not Available | 540 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10169788 | Not Available | 1492 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10727581 | Not Available | 621 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10334572 | Not Available | 963 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10361226 | Not Available | 916 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10542487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 702 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10621266 | Not Available | 644 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10495326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10765723 | Not Available | 602 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10770009 | Not Available | 600 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10822250 | Not Available | 575 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10910675 | Not Available | 537 | Open in IMG/M |
3300013372|Ga0177922_10089984 | Not Available | 776 | Open in IMG/M |
3300013372|Ga0177922_10274149 | Not Available | 684 | Open in IMG/M |
3300013372|Ga0177922_10337980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300013372|Ga0177922_10687473 | Not Available | 553 | Open in IMG/M |
3300013372|Ga0177922_10806640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300013372|Ga0177922_10829971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
3300013372|Ga0177922_10908930 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
3300013372|Ga0177922_11010231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300013372|Ga0177922_11163272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10637909 | Not Available | 581 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10728055 | Not Available | 534 | Open in IMG/M |
3300014811|Ga0119960_1082710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300017701|Ga0181364_1041663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300017716|Ga0181350_1163488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300017722|Ga0181347_1211070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300017723|Ga0181362_1035116 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
3300017736|Ga0181365_1059049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300017736|Ga0181365_1077446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300017736|Ga0181365_1110275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300017761|Ga0181356_1192084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300017774|Ga0181358_1187953 | Not Available | 683 | Open in IMG/M |
3300017777|Ga0181357_1232658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300017778|Ga0181349_1033625 | Not Available | 2056 | Open in IMG/M |
3300017778|Ga0181349_1124301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
3300017778|Ga0181349_1257386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300017785|Ga0181355_1361305 | Not Available | 532 | Open in IMG/M |
3300017788|Ga0169931_10258132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1415 | Open in IMG/M |
3300017788|Ga0169931_10536524 | Not Available | 813 | Open in IMG/M |
3300017788|Ga0169931_10886926 | Not Available | 563 | Open in IMG/M |
3300017963|Ga0180437_10379663 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
3300018416|Ga0181553_10122269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1579 | Open in IMG/M |
3300018416|Ga0181553_10153110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
3300018420|Ga0181563_10109130 | Not Available | 1797 | Open in IMG/M |
3300018420|Ga0181563_10141212 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
3300018420|Ga0181563_10242361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300018420|Ga0181563_10444069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300019784|Ga0181359_1030636 | Not Available | 2075 | Open in IMG/M |
3300019784|Ga0181359_1030802 | Not Available | 2070 | Open in IMG/M |
3300019784|Ga0181359_1052146 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
3300019784|Ga0181359_1074586 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
3300019784|Ga0181359_1094074 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
3300019784|Ga0181359_1145718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300020074|Ga0194113_10551107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300020159|Ga0211734_10383679 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
3300020205|Ga0211731_11025499 | Not Available | 510 | Open in IMG/M |
3300021092|Ga0194122_10276269 | Not Available | 867 | Open in IMG/M |
3300021376|Ga0194130_10101509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1871 | Open in IMG/M |
3300021424|Ga0194117_10350914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300021959|Ga0222716_10018208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5230 | Open in IMG/M |
3300021959|Ga0222716_10086555 | All Organisms → Viruses → Predicted Viral | 2141 | Open in IMG/M |
3300021961|Ga0222714_10023547 | All Organisms → Viruses → Predicted Viral | 4744 | Open in IMG/M |
3300021961|Ga0222714_10041018 | All Organisms → Viruses → Predicted Viral | 3313 | Open in IMG/M |
3300021961|Ga0222714_10094677 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
3300021961|Ga0222714_10100758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1828 | Open in IMG/M |
3300021961|Ga0222714_10162467 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
3300021961|Ga0222714_10206272 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
3300021961|Ga0222714_10637951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300021962|Ga0222713_10290532 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
3300021962|Ga0222713_10657619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300021963|Ga0222712_10171221 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
3300021963|Ga0222712_10203450 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
3300021963|Ga0222712_10492870 | Not Available | 726 | Open in IMG/M |
3300022190|Ga0181354_1017207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2247 | Open in IMG/M |
3300022198|Ga0196905_1023342 | All Organisms → Viruses → Predicted Viral | 1915 | Open in IMG/M |
3300022407|Ga0181351_1030159 | All Organisms → Viruses → Predicted Viral | 2305 | Open in IMG/M |
3300022752|Ga0214917_10002320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23380 | Open in IMG/M |
3300022752|Ga0214917_10030592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4051 | Open in IMG/M |
3300022752|Ga0214917_10063609 | All Organisms → Viruses → Predicted Viral | 2378 | Open in IMG/M |
3300022752|Ga0214917_10116495 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
3300022752|Ga0214917_10127122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300022752|Ga0214917_10168240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
3300022752|Ga0214917_10294013 | Not Available | 727 | Open in IMG/M |
3300022752|Ga0214917_10417838 | Not Available | 546 | Open in IMG/M |
3300022925|Ga0255773_10333740 | Not Available | 604 | Open in IMG/M |
3300022929|Ga0255752_10317257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300023174|Ga0214921_10003624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23444 | Open in IMG/M |
3300023179|Ga0214923_10026469 | All Organisms → Viruses → Predicted Viral | 4966 | Open in IMG/M |
3300023179|Ga0214923_10094589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2041 | Open in IMG/M |
3300023179|Ga0214923_10146899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
3300023179|Ga0214923_10308566 | Not Available | 856 | Open in IMG/M |
3300023179|Ga0214923_10351919 | Not Available | 776 | Open in IMG/M |
3300023184|Ga0214919_10266558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
3300024346|Ga0244775_10592882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300024346|Ga0244775_11469169 | Not Available | 522 | Open in IMG/M |
3300025646|Ga0208161_1047437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300025843|Ga0209182_10204302 | Not Available | 554 | Open in IMG/M |
3300025889|Ga0208644_1340046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300025896|Ga0208916_10001189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11386 | Open in IMG/M |
3300025896|Ga0208916_10091344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
3300025896|Ga0208916_10096864 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
3300027608|Ga0208974_1112254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300027608|Ga0208974_1173107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300027631|Ga0208133_1154493 | Not Available | 529 | Open in IMG/M |
3300027659|Ga0208975_1188291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300027659|Ga0208975_1201121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300027659|Ga0208975_1212030 | Not Available | 513 | Open in IMG/M |
3300027659|Ga0208975_1217433 | Not Available | 504 | Open in IMG/M |
3300027759|Ga0209296_1013143 | All Organisms → Viruses → Predicted Viral | 4889 | Open in IMG/M |
3300027759|Ga0209296_1188185 | Not Available | 895 | Open in IMG/M |
3300027763|Ga0209088_10005987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6891 | Open in IMG/M |
3300027785|Ga0209246_10162383 | Not Available | 877 | Open in IMG/M |
3300027798|Ga0209353_10093227 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
3300027808|Ga0209354_10016898 | All Organisms → Viruses → Predicted Viral | 2907 | Open in IMG/M |
3300027971|Ga0209401_1217527 | Not Available | 703 | Open in IMG/M |
3300032053|Ga0315284_10677264 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
3300032053|Ga0315284_11190877 | Not Available | 838 | Open in IMG/M |
3300032118|Ga0315277_10451486 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
3300033233|Ga0334722_10074690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2612 | Open in IMG/M |
3300033978|Ga0334977_0422093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300033980|Ga0334981_0483353 | Not Available | 519 | Open in IMG/M |
3300033981|Ga0334982_0065817 | All Organisms → Viruses → Predicted Viral | 1969 | Open in IMG/M |
3300033981|Ga0334982_0169480 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
3300033981|Ga0334982_0210098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300033981|Ga0334982_0265325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300033981|Ga0334982_0319515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300033992|Ga0334992_0366264 | Not Available | 656 | Open in IMG/M |
3300033993|Ga0334994_0389561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300033995|Ga0335003_0025347 | All Organisms → Viruses → Predicted Viral | 3198 | Open in IMG/M |
3300033995|Ga0335003_0362602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300034018|Ga0334985_0604261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300034019|Ga0334998_0608562 | Not Available | 594 | Open in IMG/M |
3300034062|Ga0334995_0825848 | Not Available | 504 | Open in IMG/M |
3300034072|Ga0310127_260534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300034073|Ga0310130_0004304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5829 | Open in IMG/M |
3300034073|Ga0310130_0148518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300034117|Ga0335033_0016183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4959 | Open in IMG/M |
3300034118|Ga0335053_0786778 | Not Available | 526 | Open in IMG/M |
3300034120|Ga0335056_0075447 | All Organisms → Viruses → Predicted Viral | 2126 | Open in IMG/M |
3300034120|Ga0335056_0570419 | Not Available | 587 | Open in IMG/M |
3300034120|Ga0335056_0621220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300034122|Ga0335060_0419427 | Not Available | 704 | Open in IMG/M |
3300034122|Ga0335060_0522295 | Not Available | 608 | Open in IMG/M |
3300034357|Ga0335064_0199269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1261 | Open in IMG/M |
3300034357|Ga0335064_0704978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 26.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.91% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.83% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.52% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.09% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.65% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.48% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.04% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.61% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.17% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.30% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.43% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.43% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.43% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.43% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.43% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.43% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.43% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J40625_1002179351 | 3300002835 | Freshwater | MTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSRK* |
JGI25908J49247_100048312 | 3300003277 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK* |
JGI25908J49247_101041132 | 3300003277 | Freshwater Lake | MTKTDIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK* |
JGI25909J50240_10502153 | 3300003393 | Freshwater Lake | MTKTDIQDAIRFLEKQYVGVGEQDRLFKVITSLKQELERRSKK* |
JGI25907J50239_10101771 | 3300003394 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRARK* |
JGI25913J50563_10455542 | 3300003431 | Freshwater Lake | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK* |
Ga0007787_101519162 | 3300004240 | Freshwater Lake | MTKKDIQDAIQFLEKMFVGVGDQDRLFNVIAALKEELVRRNKR* |
Ga0007787_103980742 | 3300004240 | Freshwater Lake | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0049081_100754924 | 3300005581 | Freshwater Lentic | MTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0049081_101107282 | 3300005581 | Freshwater Lentic | MTKKDIQDAIAFLEKMFVGVGDQDRLFNVIAALKEELARRNKR* |
Ga0049081_101895531 | 3300005581 | Freshwater Lentic | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKR* |
Ga0049081_102815892 | 3300005581 | Freshwater Lentic | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRAKK* |
Ga0049081_102870451 | 3300005581 | Freshwater Lentic | MTKKDIQDAIAFLERQFVGVGDQDRLFEVIAALKQELDRRSKR* |
Ga0049080_100744003 | 3300005582 | Freshwater Lentic | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR* |
Ga0049080_102903051 | 3300005582 | Freshwater Lentic | AIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK* |
Ga0079957_11077205 | 3300005805 | Lake | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSKR* |
Ga0079957_11236225 | 3300005805 | Lake | DIEDAIAFLEKIFVGPGSQDRLFEVIKSLRDELTRRNKK* |
Ga0079957_11394694 | 3300005805 | Lake | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLRDELTRRNKK* |
Ga0079957_11637125 | 3300005805 | Lake | DIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0079957_12022141 | 3300005805 | Lake | GSCPTSGGAMTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKR* |
Ga0079957_12192444 | 3300005805 | Lake | IEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKR* |
Ga0079957_12237524 | 3300005805 | Lake | IEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELVRRNKK* |
Ga0079957_12884171 | 3300005805 | Lake | DIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR* |
Ga0070744_101229362 | 3300006484 | Estuarine | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKEELTRRSKR* |
Ga0070744_101329372 | 3300006484 | Estuarine | MTKKDIRDAIAFLEKMFVGVGEQDRLFEVIASLKEELARRNK* |
Ga0070744_102206301 | 3300006484 | Estuarine | LFQPAEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0070749_101340631 | 3300006802 | Aqueous | DAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0070749_105332042 | 3300006802 | Aqueous | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSKK* |
Ga0075464_100589826 | 3300006805 | Aqueous | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRTKK* |
Ga0075464_101822731 | 3300006805 | Aqueous | KKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKR* |
Ga0075464_103609761 | 3300006805 | Aqueous | GGHMTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELDRRSKK* |
Ga0075464_105973413 | 3300006805 | Aqueous | IQDAIAFLERQYVGVGDQDRLFEVIAALKQELDKRSKR* |
Ga0075464_106688952 | 3300006805 | Aqueous | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQ |
Ga0075464_110848071 | 3300006805 | Aqueous | AIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0070750_102126241 | 3300006916 | Aqueous | MTKKDIQDAIAFLEIQFVGVGEQDRLFEVIAALKQELDKRSKK* |
Ga0070748_10322034 | 3300006920 | Aqueous | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSNK* |
Ga0075468_102507482 | 3300007229 | Aqueous | MEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0070745_10885191 | 3300007344 | Aqueous | EVKMTKNDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK* |
Ga0075458_100285484 | 3300007363 | Aqueous | MEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQ |
Ga0075458_102471221 | 3300007363 | Aqueous | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK* |
Ga0099846_13399941 | 3300007542 | Aqueous | MEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDR |
Ga0102828_10213752 | 3300007559 | Estuarine | MTKKDIEDAIDFLEKIFVGPGSQDRLFEVIKSLKDELARRNKR* |
Ga0102828_11262962 | 3300007559 | Estuarine | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARR |
Ga0102828_11462483 | 3300007559 | Estuarine | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKR* |
Ga0102859_10987223 | 3300007708 | Estuarine | MTKKDIEDAIAFLEKIFVGPSSQERLFQVINSLKVELDRRNKK* |
Ga0102859_12155682 | 3300007708 | Estuarine | MTKKDIRDAIAFLEKMFVGVGEQDRLFEVIASLKDELARRNK* |
Ga0104986_126513 | 3300007734 | Freshwater | MTKKDIQDAIAFLEKMFVGVGDQDRLFNVIAALKEELARRNKK* |
Ga0104988_1082338 | 3300007735 | Freshwater | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVINSLKQELSRRNKK* |
Ga0105745_11700422 | 3300007972 | Estuary Water | MTKKDIQDAIAFLEKMFVGVGDQDRLFNVIAALKQELDRRSKK* |
Ga0108970_103183421 | 3300008055 | Estuary | QDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKR* |
Ga0114880_12252212 | 3300008450 | Freshwater Lake | MTKKDIEDAIDFLEKIFVGPGSQDRLFEVIKSLRDELARRNKR* |
Ga0102829_11204112 | 3300009026 | Estuarine | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKK* |
Ga0105152_100343464 | 3300009039 | Lake Sediment | MTKKDIQDAIAFLQKMFVGVGDQDRLFEVIAALKEELARRNKR* |
Ga0102860_10253974 | 3300009056 | Estuarine | LSQPAEVKMTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKR* |
Ga0114981_107847542 | 3300009160 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRR |
Ga0114966_102975181 | 3300009161 | Freshwater Lake | DIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK* |
Ga0114975_101982743 | 3300009164 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGLGSQDRLFEVIKSLKDELARRAKK* |
Ga0114974_101039471 | 3300009183 | Freshwater Lake | RSPTNGGHMTKTDIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK* |
Ga0114974_104007634 | 3300009183 | Freshwater Lake | MTRKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRAKK* |
Ga0114974_104076551 | 3300009183 | Freshwater Lake | LRTQMTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK* |
Ga0114976_102752781 | 3300009184 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELAR |
Ga0114971_101502371 | 3300009185 | Freshwater Lake | RRTMSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRSKK* |
Ga0114971_104800773 | 3300009185 | Freshwater Lake | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAK |
Ga0116204_11245723 | 3300010293 | Anoxic Lake Water | VTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELTRRNKK* |
Ga0129336_107657112 | 3300010370 | Freshwater To Marine Saline Gradient | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKEELTRRSKK* |
Ga0133913_100565288 | 3300010885 | Freshwater Lake | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRTKK* |
Ga0133913_135386864 | 3300010885 | Freshwater Lake | LCFGWVGFLTLRTQMTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRAKK* |
Ga0151514_1040921 | 3300011115 | Freshwater | MTKKDIQDAIAFLEKMFVGVGDQDRLFEVIAALKEELARRNKR* |
Ga0151516_106446 | 3300011116 | Freshwater | MTKKDIQDAIQFLEKMFVGVGDQDRLFNVIAALKEELARRNKR* |
Ga0151620_11548013 | 3300011268 | Freshwater | QDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK* |
Ga0153702_175212 | 3300011337 | Freshwater | MTKRDIEDAIAFLEKIFVGPGSQDRLFEVIKSLRDELTRRNKR* |
Ga0153800_10184572 | 3300011995 | Freshwater | MEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR* |
Ga0153800_10236042 | 3300011995 | Freshwater | MTKTDIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRS |
Ga0119955_11124642 | 3300012006 | Freshwater | MTKKDIQDAIKFLEKQFVGVGEQDRLFEVIAALKEELARRNKR* |
Ga0153805_10258885 | 3300012013 | Surface Ice | EDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRTKK* |
Ga0164294_110882591 | 3300013006 | Freshwater | MTKKDIEDAIAFLEKIFVGPGSQDRLFEIIKSLKDELARRAKK* |
Ga0164295_107288193 | 3300013014 | Freshwater | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKR* |
Ga0163212_10182793 | 3300013087 | Freshwater | VTKQDIRDAIAFLQKIYVGVGEQDRLFRVIEALKEELARRNKK* |
(restricted) Ga0172374_10283101 | 3300013122 | Freshwater | VTKQDIRDAIAFLEKIYVGVGEQDRLFHVIEALKQELARRNKK* |
(restricted) Ga0172374_11156901 | 3300013122 | Freshwater | QDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELTRRNKK* |
(restricted) Ga0172367_104108513 | 3300013126 | Freshwater | VTKQDIRDAIAFLQKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172367_104124521 | 3300013126 | Freshwater | VTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172367_105694441 | 3300013126 | Freshwater | TKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELTRRNKK* |
(restricted) Ga0172367_106070043 | 3300013126 | Freshwater | EVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELNKRSKKCQ* |
(restricted) Ga0172367_106872053 | 3300013126 | Freshwater | VTKQDIRNAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172363_101697885 | 3300013130 | Sediment | GSAPTAEVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172363_107275811 | 3300013130 | Sediment | GSAPTAEVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELNKRSKKCQ* |
(restricted) Ga0172373_103345724 | 3300013131 | Freshwater | EVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172373_103612261 | 3300013131 | Freshwater | TAEVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172373_105424871 | 3300013131 | Freshwater | DIRDAIAFLEKIYVGVGEQDRLFEVIAALKDELARRNKR* |
(restricted) Ga0172373_106212662 | 3300013131 | Freshwater | MTKKDLRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172372_104953263 | 3300013132 | Freshwater | VTKQDIRDAIAFLEKIYVGVGEQDRLFEVIAALKDELARRNKR* |
(restricted) Ga0172372_107657231 | 3300013132 | Freshwater | TKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172372_107700093 | 3300013132 | Freshwater | GSAPTAEVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKR* |
(restricted) Ga0172372_108222501 | 3300013132 | Freshwater | KVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELTRRNKK* |
(restricted) Ga0172372_109106751 | 3300013132 | Freshwater | AIAFLEKIYVGVGEQDRLFQVIEALKQELTKRSKK* |
Ga0177922_100899842 | 3300013372 | Freshwater | MTRKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRTKK* |
Ga0177922_102741493 | 3300013372 | Freshwater | TKTDIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK* |
Ga0177922_103379803 | 3300013372 | Freshwater | MTKKDIQDAIAFLEKMFVGVGDQDRLFEVIASLKEELTRRNKR* |
Ga0177922_106874732 | 3300013372 | Freshwater | MTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKR* |
Ga0177922_108066401 | 3300013372 | Freshwater | DIQDAIQFLEKMFVGVGDQDRLFNVIAALKEELARRNKR* |
Ga0177922_108299713 | 3300013372 | Freshwater | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKK* |
Ga0177922_109089301 | 3300013372 | Freshwater | DIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRKSKR* |
Ga0177922_110102312 | 3300013372 | Freshwater | KDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDKRSKK* |
Ga0177922_111632721 | 3300013372 | Freshwater | IAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKK* |
(restricted) Ga0172376_106379093 | 3300014720 | Freshwater | PTAEVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK* |
(restricted) Ga0172376_107280553 | 3300014720 | Freshwater | SAPTAEVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELTRRNKK* |
Ga0119960_10827102 | 3300014811 | Aquatic | FPVTIEKEMTKKDIQDAIAFLEKMFVGVGDQDRLFNVIAALKEELARRNKR* |
Ga0181364_10416633 | 3300017701 | Freshwater Lake | MTKKDIQDAIAFVEKQYVGVGDQDRLFEVIAALKEELTRRSKK |
Ga0181350_11634881 | 3300017716 | Freshwater Lake | EDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK |
Ga0181347_12110701 | 3300017722 | Freshwater Lake | DAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK |
Ga0181362_10351163 | 3300017723 | Freshwater Lake | MTRKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRTKK |
Ga0181365_10590493 | 3300017736 | Freshwater Lake | LFQPAEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELERRSKK |
Ga0181365_10774462 | 3300017736 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGPGSQERLFEVIKSLKDELARRAKK |
Ga0181365_11102751 | 3300017736 | Freshwater Lake | LRTQMTKKDIEDAIAFLEKIFVGPGSQERLFQVINSLKVELDRRNKK |
Ga0181356_11920842 | 3300017761 | Freshwater Lake | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQEL |
Ga0181358_11879533 | 3300017774 | Freshwater Lake | RTQMTKKDIEDAIAFLEKIFVGPSSQERLFQVINSLKVELDRRNKK |
Ga0181357_12326584 | 3300017777 | Freshwater Lake | GFLTLRTQMTKKDIEDAIAFLEKIFVGPSSQERLFQVINSLKVELDRRNKK |
Ga0181349_10336251 | 3300017778 | Freshwater Lake | GGHMTKTDIQDAIRFLEKQYVGVGEQDRLFEVITALKQELERRSKK |
Ga0181349_11243013 | 3300017778 | Freshwater Lake | KTDIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK |
Ga0181349_12573861 | 3300017778 | Freshwater Lake | TNGGQMTKKDIRDAIAFLEKMFVGVGEQDRLFEVIASLKEELARRNK |
Ga0181355_13613052 | 3300017785 | Freshwater Lake | MEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSKR |
Ga0169931_102581322 | 3300017788 | Freshwater | VTKQDIRDAIAFLQKIYVGVGEQDRLFQVIEALKQELARRNKK |
Ga0169931_105365241 | 3300017788 | Freshwater | VTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELARRNKK |
Ga0169931_108869261 | 3300017788 | Freshwater | GSAPTAEVKVTKQDIRDAIAFLEKIYVGVGEQDRLFQVIEALKQELTRRNKK |
Ga0180437_103796632 | 3300017963 | Hypersaline Lake Sediment | MEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0181553_101222696 | 3300018416 | Salt Marsh | VGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKEELARRNKR |
Ga0181553_101531102 | 3300018416 | Salt Marsh | MTKKDIQDAIKFLEKQFVGVGEQDRLFEVIAALKEELARRNKR |
Ga0181563_101091302 | 3300018420 | Salt Marsh | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK |
Ga0181563_101412123 | 3300018420 | Salt Marsh | MTKKDIQDAIRFLEKQFVGVGEQDRLFEVIAALKEELARRNKR |
Ga0181563_102423613 | 3300018420 | Salt Marsh | MTKKDIQDAIAFLEKMFVGVGDQDRLFEVIAALKEELARRNKR |
Ga0181563_104440692 | 3300018420 | Salt Marsh | MTKKDIQDAIRFLEKQYVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0181359_10306361 | 3300019784 | Freshwater Lake | RMTKKDIQDAIAFLEKQYVGVGDQDRLFEVIAALKEELTRRSKK |
Ga0181359_10308021 | 3300019784 | Freshwater Lake | DIEDAIDFLEKIFVGPGSQDRLFEVIKSLRDELARRNKR |
Ga0181359_10521464 | 3300019784 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK |
Ga0181359_10745861 | 3300019784 | Freshwater Lake | PTNGGHMTKTDIQDAIRFLEKQYVGVGEQDRLFKVITSLKQELERRSKK |
Ga0181359_10940741 | 3300019784 | Freshwater Lake | MTKTDIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK |
Ga0181359_11457182 | 3300019784 | Freshwater Lake | MTKKDIRDAIAFLEKMFVGVGEQDRLFEVIASLKEELARRNK |
Ga0194113_105511072 | 3300020074 | Freshwater Lake | VTKQDIRDAIAFLQKIYVGVGEQDRLFRVIEALKEELARRNKK |
Ga0211734_103836792 | 3300020159 | Freshwater | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKEELTRRSKK |
Ga0211731_110254992 | 3300020205 | Freshwater | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKK |
Ga0194122_102762693 | 3300021092 | Freshwater Lake | SFPTTEAKVTKQDIRDAIAFLEKIYVGVGEQDRLFRVIEALKQELARRNKK |
Ga0194130_101015092 | 3300021376 | Freshwater Lake | VTKQDIRDAIAFLEKIYVGVGEQDRLFRVIEALKEELARRNKK |
Ga0194117_103509142 | 3300021424 | Freshwater Lake | VTKQDIRDAIAFLEKIYVGVGEQDRLFRVIEALKQELARRNKK |
Ga0222716_100182089 | 3300021959 | Estuarine Water | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELYRRSKK |
Ga0222716_100865551 | 3300021959 | Estuarine Water | MTKEDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0222714_1002354711 | 3300021961 | Estuarine Water | GMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0222714_100410187 | 3300021961 | Estuarine Water | MEVGMTKKDIQDAIAFLERQFVGVGDQDRLFNVIAALKEELARRNKR |
Ga0222714_100946775 | 3300021961 | Estuarine Water | MTKKDIRDAIAFLEKMFVGVGEQDRLFEVIASLKEELERRSKR |
Ga0222714_101007581 | 3300021961 | Estuarine Water | PMEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0222714_101624675 | 3300021961 | Estuarine Water | IQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0222714_102062721 | 3300021961 | Estuarine Water | LSQPAEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKEELARRNKR |
Ga0222714_106379512 | 3300021961 | Estuarine Water | QDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0222713_102905324 | 3300021962 | Estuarine Water | MEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0222713_106576193 | 3300021962 | Estuarine Water | DIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0222712_101712214 | 3300021963 | Estuarine Water | IQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK |
Ga0222712_102034504 | 3300021963 | Estuarine Water | MTKKDIRDAIAFLEKMFVGVGDQDRLFEVIAALKEELARRNK |
Ga0222712_104928703 | 3300021963 | Estuarine Water | MTKKDIEDAIAFLEKIFVGPGSQERLFQVINSLKVELDRRNKK |
Ga0181354_10172073 | 3300022190 | Freshwater Lake | MTKKDIEDAIDFLEKIFVGPGSQDRLFEVIKSLRDELARRNKR |
Ga0196905_10233421 | 3300022198 | Aqueous | TKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0181351_10301591 | 3300022407 | Freshwater Lake | AKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK |
Ga0214917_1000232011 | 3300022752 | Freshwater | MTKKDIEDAIAFLEKIFVGPGSQDRLFELIKSLKDELARRAKK |
Ga0214917_100305925 | 3300022752 | Freshwater | MTKKDIQDAIAFLERQFVGVGEQDRLFKVIAALKQELDRRSKK |
Ga0214917_100636093 | 3300022752 | Freshwater | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKK |
Ga0214917_101164953 | 3300022752 | Freshwater | LSQPTEVTMTKKDIQDAIRFLEKQFVGVGEQDRLFEVIAALKEELARRNKR |
Ga0214917_101271223 | 3300022752 | Freshwater | MTKKDIQDAIAFLEKMFVGVGDQDRLFEVIAALKEELARRNKK |
Ga0214917_101682401 | 3300022752 | Freshwater | MTKKDIQDAIRFLEKQFVGVGEQDRLFEVIAALKQELEKRSKK |
Ga0214917_102940134 | 3300022752 | Freshwater | FWSLCFGWVGFLTIRRTMSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKK |
Ga0214917_104178381 | 3300022752 | Freshwater | MTKKDIQDAIRFLEKQFVGVGEQDRLFEVIAALKEELARRSKK |
Ga0255773_103337402 | 3300022925 | Salt Marsh | MTKKDIQDAIAFLEKMFVGVGDQDRLFEVIAALKEELARRSKK |
Ga0255752_103172571 | 3300022929 | Salt Marsh | MTKKDIQDAIRFLEKQYVGVGEQDRLFEVIAALKQELD |
Ga0214921_1000362430 | 3300023174 | Freshwater | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRAKK |
Ga0214923_100264699 | 3300023179 | Freshwater | MEVGMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSKK |
Ga0214923_100945893 | 3300023179 | Freshwater | MTKKDIQDAIAFLEKIFVGVGDQDRLFEVIAALKEELARRNKR |
Ga0214923_101468995 | 3300023179 | Freshwater | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKEM |
Ga0214923_103085663 | 3300023179 | Freshwater | MTKKDIQDAIAFLEKQYVGVADQDRLFEVIAALKEELARRAKK |
Ga0214923_103519194 | 3300023179 | Freshwater | LTLRTQMTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRAKK |
Ga0214919_102665582 | 3300023184 | Freshwater | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKR |
Ga0244775_105928822 | 3300024346 | Estuarine | MTKKDIEDAIDFLEKIFVGPGSQDRLFEVIKSLKDELARRNKR |
Ga0244775_114691691 | 3300024346 | Estuarine | MTKKDIQDAIAFLERMFVGVGDQDRLFEVIAALKEELTR |
Ga0208161_10474373 | 3300025646 | Aqueous | EVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0209182_102043022 | 3300025843 | Lake Sediment | MTKKDIQDAIAFLQKMFVGVGDQDRLFEVIAALKEELARRNKR |
Ga0208644_13400463 | 3300025889 | Aqueous | QPAEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0208916_100011893 | 3300025896 | Aqueous | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSKR |
Ga0208916_100913443 | 3300025896 | Aqueous | MSKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRTKK |
Ga0208916_100968644 | 3300025896 | Aqueous | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELDRRSKK |
Ga0208974_11122541 | 3300027608 | Freshwater Lentic | GGHMTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK |
Ga0208974_11731071 | 3300027608 | Freshwater Lentic | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERR |
Ga0208133_11544932 | 3300027631 | Estuarine | LFQPAEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0208975_11882911 | 3300027659 | Freshwater Lentic | DIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0208975_12011211 | 3300027659 | Freshwater Lentic | VRFLFQPAEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0208975_12120302 | 3300027659 | Freshwater Lentic | MQSKVLVLPMEVDMTKKDIQDALAFLEKMFVGVGDQDRLFNVIAALKEELARRNKR |
Ga0208975_12174332 | 3300027659 | Freshwater Lentic | MTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRNKR |
Ga0209296_10131431 | 3300027759 | Freshwater Lake | TLRTQMTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK |
Ga0209296_11881852 | 3300027759 | Freshwater Lake | MTKKDIEDAIAFLEKIFVGLGSQDRLFEVIKSLKDELARRAKK |
Ga0209088_100059872 | 3300027763 | Freshwater Lake | MTKTDIQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRNKK |
Ga0209246_101623834 | 3300027785 | Freshwater Lake | IQDAIRFLEKQYVGVGEQDRLFEVITSLKQELERRSKK |
Ga0209353_100932276 | 3300027798 | Freshwater Lake | MTKTDIQDAIRFLEKQYVGVGEQDRLFKVITSLKQELERRSKK |
Ga0209354_100168981 | 3300027808 | Freshwater Lake | RTQMTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRAKK |
Ga0209401_12175273 | 3300027971 | Freshwater Lake | GWVGFLTLRTQMTKKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELTRRAKK |
Ga0315284_106772643 | 3300032053 | Sediment | MTKKDIRDAIAFLEKMFVGVGDQDRLFEVIASLKEELARRNK |
Ga0315284_111908773 | 3300032053 | Sediment | MTRKDIEDAIAFLEKIFVGPGSQDRLFEVIKSLKDELARRNKR |
Ga0315277_104514862 | 3300032118 | Sediment | MTKTDIQDAITFLEKQYVGVGEQDRLFEVITALKQELERRSKK |
Ga0334722_100746902 | 3300033233 | Sediment | MTKKDLEDAIDFLEKIFVGPGSQDRLFEVIKSLRDELARRNKR |
Ga0334977_0422093_1_126 | 3300033978 | Freshwater | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSK |
Ga0334981_0483353_261_416 | 3300033980 | Freshwater | LFQPAEVEMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0334982_0065817_1820_1969 | 3300033981 | Freshwater | PTNGGHMTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK |
Ga0334982_0169480_2_148 | 3300033981 | Freshwater | PAEVKMTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0334982_0210098_184_315 | 3300033981 | Freshwater | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0334982_0265325_155_286 | 3300033981 | Freshwater | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSKK |
Ga0334982_0319515_598_723 | 3300033981 | Freshwater | KKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0334992_0366264_115_246 | 3300033992 | Freshwater | MTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSRK |
Ga0334994_0389561_14_169 | 3300033993 | Freshwater | LFQPAEVKMTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSRK |
Ga0335003_0025347_1_117 | 3300033995 | Freshwater | IQDAIAFLERQFVGVGEQDRLFEVIAALKQELDKRSKR |
Ga0335003_0362602_2_115 | 3300033995 | Freshwater | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELD |
Ga0334985_0604261_3_107 | 3300034018 | Freshwater | MTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQ |
Ga0334998_0608562_3_128 | 3300034019 | Freshwater | KKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0334995_0825848_229_360 | 3300034062 | Freshwater | MTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDKRSKK |
Ga0310127_260534_82_225 | 3300034072 | Fracking Water | MEVRMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0310130_0004304_1873_2016 | 3300034073 | Fracking Water | MEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKK |
Ga0310130_0148518_1_126 | 3300034073 | Fracking Water | KKDIQDAIAFLERQFVGIGEQDRLFEVIAALKQELDRRSKR |
Ga0335033_0016183_2_115 | 3300034117 | Freshwater | QDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK |
Ga0335053_0786778_417_524 | 3300034118 | Freshwater | AIAFLERQYVGVGDQDRLFEVIAALKQELERRSKK |
Ga0335056_0075447_2_127 | 3300034120 | Freshwater | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELERRSK |
Ga0335056_0570419_36_191 | 3300034120 | Freshwater | MFQPAEVNMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0335056_0621220_2_115 | 3300034120 | Freshwater | MTKKDIQDAIAFLERQYVGVGDQDRLFEVIAALKQELE |
Ga0335060_0419427_184_339 | 3300034122 | Freshwater | MFQPAEVKMTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0335060_0522295_1_135 | 3300034122 | Freshwater | KMTKKDIQDAIAFLEKQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0335064_0199269_1141_1260 | 3300034357 | Freshwater | DIQDAIAFLERQFVGVGEQDRLFEVIAALKQELDRRSKR |
Ga0335064_0704978_3_110 | 3300034357 | Freshwater | MTKKDIQDAIAFLERQFVGVGEQDRLFEVIAALKQE |
⦗Top⦘ |