| Basic Information | |
|---|---|
| Taxon OID | 3300011249 Open in IMG/M |
| Scaffold ID | Ga0137489_1011875 Open in IMG/M |
| Source Dataset Name | Basal ice microbial communities from dark ice on Arctic glacier surface, Midre Lovenbreen, Svalbard, Norway (sample 23) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1248 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Basal Ice → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Midre Lovenbreen Svalbard, Norway | |||||||
| Coordinates | Lat. (o) | 79.48416667 | Long. (o) | 12.09222222 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069623 | Metagenome / Metatranscriptome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137489_10118752 | F069623 | AGAAGG | MKSSAEIDINQRVFALQHMDSGEYICLLQEGTDYLACFSDGDSALEFRSSLGLQEHVDLQAMTLDHSPFKHFWLDGENVDIRQEQEVAN* |
| ⦗Top⦘ |