| Basic Information | |
|---|---|
| Taxon OID | 3300011237 Open in IMG/M |
| Scaffold ID | Ga0137008_104851 Open in IMG/M |
| Source Dataset Name | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 2 - S13.2.20.a - transect 2, age 3 years, surface depth) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1014 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Midre Lovenbreen, Svalbard | |||||||
| Coordinates | Lat. (o) | 79.112223 | Long. (o) | 12.175 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008258 | Metagenome / Metatranscriptome | 336 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137008_1048513 | F008258 | GAGG | VTQDPIEQALDKLGSLGVPVNDISEKAGAIVGQFGSFDLFEMLDQAMSIDPSQLDVGEMFAELKSKYDDLDPALKVPVAIAAGFVGARVVRWIVR* |
| ⦗Top⦘ |