Scaffold Ga0137475_100615

Overview

Basic Information

• Taxon OID: 3300011227
• Scaffold ID: Ga0137475_100615
• Source Dataset Name: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 10 - S13.1.50.a - transect 1, age 50 years, surface depth).
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3003
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Midre Lovenbreen Svalbard, Norway
• Coordinates
  • Lat. (^o): 78.92777778
  • Long. (^o): 12.25416667
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056720	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137475_1006154	F056720	GGA	MGRRMNFAPRMPTIIVALVFVLIGVIGTFGGMLPSLAGMSSQALGAWSFVVAAVVMIAGMIFSGI*