Scaffold Ga0137470_104287

Overview

Basic Information

• Taxon OID: 3300011197
• Scaffold ID: Ga0137470_104287
• Source Dataset Name: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 5 - S13.2.30.a - transect 2, age 5 years, surface depth)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 554
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Norway: Midre Lovenbreen, Svalbard
• Coordinates
  • Lat. (^o): 79.11361111
  • Long. (^o): 12.19583333
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004265	Metagenome / Metatranscriptome	446	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137470_1042871	F004265	N/A	VQSWNLLQIDAPGGTVDPTVLYSGEARAVLIAFEPGQALGEHEVKERAFLTVVA