NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011197

3300011197: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 5 - S13.2.30.a - transect 2, age 5 years, surface depth)



Overview

Basic Information
IMG/M Taxon OID3300011197 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121480 | Gp0155456 | Ga0137470
Sample NameArctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 5 - S13.2.30.a - transect 2, age 5 years, surface depth)
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Bristol
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size10899365
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp.1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes Of Arctic Soils
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeglacial featuresoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationNorway: Midre Lovenbreen, Svalbard
CoordinatesLat. (o)79.11361111Long. (o)12.19583333Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004265Metagenome / Metatranscriptome446Y
F027031Metagenome196Y
F049731Metagenome / Metatranscriptome146Y
F087943Metagenome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0137470_100928All Organisms → cellular organisms → Bacteria1175Open in IMG/M
Ga0137470_101298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1038Open in IMG/M
Ga0137470_102792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp.719Open in IMG/M
Ga0137470_104287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium554Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0137470_100928Ga0137470_1009282F049731ARETRALVRLRRREDGAVEVRSCAVKSRAVSNRNCVAVRRGGEHRNENDQSVTQTARMGRRRELDSVGVDGRASSDWRSL*
Ga0137470_101298Ga0137470_1012981F027031MGREERDVVEAVVASLPVTVTAWSDGAATLDPLDIVAIRRPIASLSSSGAGRWWVGPREVKPELAEISATGTVYDSVVALWPCDPGVPQCGWGCTIGPSETTFGAGFSSISTDHWRSLTTDPDPVQGYVHEWLHQVEAVYRALGLSEAVLPPLHDAASFTSTRPIDEPPFGRSYAEYHDGDASQLPAARTWAPWYGDWMTGRLRPIGAVQQADQPIGLTPGRWSLRSRS*
Ga0137470_102792Ga0137470_1027922F087943LVSEAHHPVVILYEYPLLGEGIAKYLRAQLGVEAMIASWDDLEAVTAALAMGPAVVIFELSDRLRQLDLAALAPHADLIDVSTVVARGPVDSSGAAGLERILQAVRDCITVDE*
Ga0137470_104287Ga0137470_1042871F004265VQSWNLLQIDAPGGTVDPTVLYSGEARAVLIAFEPGQALGEHEVKERAFLTVVA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.