Scaffold Ga0137479_100153

Overview

Basic Information

• Taxon OID: 3300011194
• Scaffold ID: Ga0137479_100153
• Source Dataset Name: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 14 - S13.2.55.2.a - transect 2, repeat 2, age 50-113 years, surface depth).
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11393
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Midre Lovenbreen Svalbard, Norway
• Coordinates
  • Lat. (^o): 78.90055556
  • Long. (^o): 12.07611111
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010124	Metagenome	308	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137479_10015312	F010124	GGAG	MKKYMTLLVASVLVLASVSLPVAAKQGDTQTSTFEKVRIKIAKLGVGEKAKATVYLKDGTKKKGYIAQAGDDDFVLRDRNTDAATTIRYLDVTKVDSNRGHSTARNVTIGVVAGVGAVLAVLGLLIANLDD*