Basic Information | |
---|---|
Taxon OID | 3300011120 Open in IMG/M |
Scaffold ID | Ga0150983_12905988 Open in IMG/M |
Source Dataset Name | Combined assembly of Microbial Forest Soil metaT |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 552 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Harvard Forest LTER, Petersham, MA, USA | |||||||
Coordinates | Lat. (o) | 42.532967 | Long. (o) | -72.180244 | Alt. (m) | Depth (m) | 0 to .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039620 | Metagenome / Metatranscriptome | 163 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0150983_129059882 | F039620 | N/A | ATAALVAIWAVAAVVDGGTWFPWWTVIVLPWIWVLIRGAQRRGE* |
⦗Top⦘ |