| Basic Information | |
|---|---|
| Family ID | F039620 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TSALVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.23 % |
| % of genes near scaffold ends (potentially truncated) | 95.71 % |
| % of genes from short scaffolds (< 2000 bps) | 95.09 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.098 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.061 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.380 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.920 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF01176 | eIF-1a | 53.99 |
| PF00416 | Ribosomal_S13 | 14.11 |
| PF00444 | Ribosomal_L36 | 6.13 |
| PF00411 | Ribosomal_S11 | 1.84 |
| PF00163 | Ribosomal_S4 | 1.23 |
| PF03118 | RNA_pol_A_CTD | 0.61 |
| PF01479 | S4 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 53.99 |
| COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 14.11 |
| COG0257 | Ribosomal protein L36 | Translation, ribosomal structure and biogenesis [J] | 6.13 |
| COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 1.84 |
| COG0522 | Ribosomal protein S4 or related protein | Translation, ribosomal structure and biogenesis [J] | 1.23 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.10 % |
| All Organisms | root | All Organisms | 31.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10348965 | Not Available | 908 | Open in IMG/M |
| 3300002915|JGI25387J43893_1053265 | Not Available | 577 | Open in IMG/M |
| 3300004121|Ga0058882_1022196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2311 | Open in IMG/M |
| 3300004607|Ga0068948_1030522 | Not Available | 1436 | Open in IMG/M |
| 3300005169|Ga0066810_10013251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1262 | Open in IMG/M |
| 3300005185|Ga0066811_1001842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
| 3300005436|Ga0070713_100942078 | Not Available | 831 | Open in IMG/M |
| 3300005518|Ga0070699_100959685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 783 | Open in IMG/M |
| 3300005529|Ga0070741_10047682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 5292 | Open in IMG/M |
| 3300005537|Ga0070730_11026128 | Not Available | 514 | Open in IMG/M |
| 3300005541|Ga0070733_10247576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1171 | Open in IMG/M |
| 3300005591|Ga0070761_10307799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 954 | Open in IMG/M |
| 3300006052|Ga0075029_101052150 | Not Available | 564 | Open in IMG/M |
| 3300006052|Ga0075029_101355006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300006573|Ga0074055_10018500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2389 | Open in IMG/M |
| 3300006574|Ga0074056_10018208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3780 | Open in IMG/M |
| 3300006800|Ga0066660_10821488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300009088|Ga0099830_10765166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300009672|Ga0116215_1445336 | Not Available | 560 | Open in IMG/M |
| 3300009700|Ga0116217_10795546 | Not Available | 582 | Open in IMG/M |
| 3300009700|Ga0116217_11019956 | Not Available | 506 | Open in IMG/M |
| 3300009824|Ga0116219_10279330 | Not Available | 944 | Open in IMG/M |
| 3300010090|Ga0127471_1009551 | Not Available | 531 | Open in IMG/M |
| 3300010111|Ga0127491_1142894 | Not Available | 519 | Open in IMG/M |
| 3300010335|Ga0134063_10281119 | Not Available | 797 | Open in IMG/M |
| 3300010336|Ga0134071_10243710 | Not Available | 894 | Open in IMG/M |
| 3300010360|Ga0126372_10164835 | Not Available | 1794 | Open in IMG/M |
| 3300010379|Ga0136449_103851258 | Not Available | 563 | Open in IMG/M |
| 3300010859|Ga0126352_1088351 | Not Available | 596 | Open in IMG/M |
| 3300010864|Ga0126357_1016901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300010869|Ga0126359_1820491 | Not Available | 618 | Open in IMG/M |
| 3300011120|Ga0150983_12905988 | Not Available | 552 | Open in IMG/M |
| 3300011120|Ga0150983_15983930 | Not Available | 565 | Open in IMG/M |
| 3300011269|Ga0137392_10352265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1220 | Open in IMG/M |
| 3300012198|Ga0137364_11316020 | Not Available | 538 | Open in IMG/M |
| 3300012210|Ga0137378_11107238 | Not Available | 707 | Open in IMG/M |
| 3300012210|Ga0137378_11462666 | Not Available | 595 | Open in IMG/M |
| 3300012212|Ga0150985_106869776 | Not Available | 515 | Open in IMG/M |
| 3300012349|Ga0137387_10945103 | Not Available | 621 | Open in IMG/M |
| 3300012350|Ga0137372_10941598 | Not Available | 608 | Open in IMG/M |
| 3300012478|Ga0157328_1010175 | Not Available | 646 | Open in IMG/M |
| 3300012515|Ga0157338_1005554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
| 3300012971|Ga0126369_10447070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
| 3300012984|Ga0164309_11179085 | Not Available | 641 | Open in IMG/M |
| 3300013100|Ga0157373_10858735 | Not Available | 672 | Open in IMG/M |
| 3300014201|Ga0181537_10030650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3711 | Open in IMG/M |
| 3300014497|Ga0182008_10463452 | Not Available | 691 | Open in IMG/M |
| 3300015265|Ga0182005_1066274 | Not Available | 989 | Open in IMG/M |
| 3300016270|Ga0182036_10116164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1848 | Open in IMG/M |
| 3300017823|Ga0187818_10280828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300017823|Ga0187818_10333911 | Not Available | 668 | Open in IMG/M |
| 3300017928|Ga0187806_1333634 | Not Available | 540 | Open in IMG/M |
| 3300017970|Ga0187783_10347081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1080 | Open in IMG/M |
| 3300017972|Ga0187781_10650009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 761 | Open in IMG/M |
| 3300017999|Ga0187767_10081012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
| 3300019164|Ga0184582_128056 | Not Available | 590 | Open in IMG/M |
| 3300019180|Ga0184578_114671 | Not Available | 1174 | Open in IMG/M |
| 3300019192|Ga0184603_135552 | Not Available | 569 | Open in IMG/M |
| 3300019284|Ga0187797_1437304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1639 | Open in IMG/M |
| 3300020580|Ga0210403_10588179 | Not Available | 899 | Open in IMG/M |
| 3300020580|Ga0210403_10710917 | Not Available | 804 | Open in IMG/M |
| 3300020582|Ga0210395_11365177 | Not Available | 517 | Open in IMG/M |
| 3300021181|Ga0210388_10707299 | Not Available | 877 | Open in IMG/M |
| 3300021432|Ga0210384_10392284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1250 | Open in IMG/M |
| 3300021477|Ga0210398_11579306 | Not Available | 509 | Open in IMG/M |
| 3300021559|Ga0210409_10110522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2530 | Open in IMG/M |
| 3300021560|Ga0126371_11032758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300021560|Ga0126371_13190462 | Not Available | 554 | Open in IMG/M |
| 3300021861|Ga0213853_11500908 | Not Available | 645 | Open in IMG/M |
| 3300022530|Ga0242658_1083991 | Not Available | 737 | Open in IMG/M |
| 3300022709|Ga0222756_1085860 | Not Available | 520 | Open in IMG/M |
| 3300022711|Ga0242674_1001327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1936 | Open in IMG/M |
| 3300022713|Ga0242677_1046048 | Not Available | 628 | Open in IMG/M |
| 3300022721|Ga0242666_1014698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1401 | Open in IMG/M |
| 3300023533|Ga0247537_102713 | Not Available | 546 | Open in IMG/M |
| 3300024055|Ga0247794_10067112 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300026325|Ga0209152_10183164 | Not Available | 786 | Open in IMG/M |
| 3300026999|Ga0207949_1002004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1737 | Open in IMG/M |
| 3300027166|Ga0208729_102587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
| 3300027545|Ga0209008_1069216 | Not Available | 796 | Open in IMG/M |
| 3300027567|Ga0209115_1055188 | Not Available | 905 | Open in IMG/M |
| 3300027701|Ga0209447_10180413 | Not Available | 579 | Open in IMG/M |
| 3300027768|Ga0209772_10071061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
| 3300027853|Ga0209274_10431682 | Not Available | 681 | Open in IMG/M |
| 3300027884|Ga0209275_10763435 | Not Available | 557 | Open in IMG/M |
| 3300027908|Ga0209006_10306791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1353 | Open in IMG/M |
| 3300027911|Ga0209698_10734406 | Not Available | 750 | Open in IMG/M |
| 3300027986|Ga0209168_10315296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300028759|Ga0302224_10064113 | Not Available | 1386 | Open in IMG/M |
| 3300028773|Ga0302234_10529749 | Not Available | 503 | Open in IMG/M |
| 3300028789|Ga0302232_10083791 | Not Available | 1645 | Open in IMG/M |
| 3300028885|Ga0307304_10318020 | Not Available | 690 | Open in IMG/M |
| 3300029943|Ga0311340_10200791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2008 | Open in IMG/M |
| 3300029944|Ga0311352_11301036 | Not Available | 549 | Open in IMG/M |
| 3300030058|Ga0302179_10370010 | Not Available | 631 | Open in IMG/M |
| 3300030532|Ga0210290_1460999 | Not Available | 730 | Open in IMG/M |
| 3300030545|Ga0210271_10358480 | Not Available | 680 | Open in IMG/M |
| 3300030573|Ga0210272_1012699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300030577|Ga0210260_10020935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1146 | Open in IMG/M |
| 3300030578|Ga0210275_10322831 | Not Available | 545 | Open in IMG/M |
| 3300030578|Ga0210275_10371348 | Not Available | 518 | Open in IMG/M |
| 3300030580|Ga0311355_11818021 | Not Available | 516 | Open in IMG/M |
| 3300030582|Ga0210261_1006021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1256 | Open in IMG/M |
| 3300030595|Ga0210276_10916894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1328 | Open in IMG/M |
| 3300030596|Ga0210278_1076486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 705 | Open in IMG/M |
| 3300030603|Ga0210253_11209109 | Not Available | 1000 | Open in IMG/M |
| 3300030617|Ga0311356_10243226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1822 | Open in IMG/M |
| 3300030623|Ga0265392_1203880 | Not Available | 548 | Open in IMG/M |
| 3300030627|Ga0210269_10000317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2528 | Open in IMG/M |
| 3300030631|Ga0210279_10441389 | Not Available | 529 | Open in IMG/M |
| 3300030741|Ga0265459_12679450 | Not Available | 618 | Open in IMG/M |
| 3300030743|Ga0265461_12956100 | Not Available | 570 | Open in IMG/M |
| 3300030743|Ga0265461_13871638 | Not Available | 509 | Open in IMG/M |
| 3300030763|Ga0265763_1040806 | Not Available | 559 | Open in IMG/M |
| 3300030763|Ga0265763_1056917 | Not Available | 503 | Open in IMG/M |
| 3300030840|Ga0074020_11264751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 759 | Open in IMG/M |
| 3300030875|Ga0265727_103418 | Not Available | 533 | Open in IMG/M |
| 3300030882|Ga0265764_100560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1442 | Open in IMG/M |
| 3300030907|Ga0074013_11852438 | Not Available | 749 | Open in IMG/M |
| 3300031040|Ga0265754_1019105 | Not Available | 623 | Open in IMG/M |
| 3300031043|Ga0265779_104428 | Not Available | 748 | Open in IMG/M |
| 3300031231|Ga0170824_121894819 | Not Available | 541 | Open in IMG/M |
| 3300031446|Ga0170820_12435291 | Not Available | 608 | Open in IMG/M |
| 3300031446|Ga0170820_14013801 | Not Available | 1164 | Open in IMG/M |
| 3300031543|Ga0318516_10596875 | Not Available | 630 | Open in IMG/M |
| 3300031549|Ga0318571_10106658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300031564|Ga0318573_10558434 | Not Available | 616 | Open in IMG/M |
| 3300031668|Ga0318542_10743211 | Not Available | 513 | Open in IMG/M |
| 3300031713|Ga0318496_10340075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300031715|Ga0307476_10396868 | Not Available | 1018 | Open in IMG/M |
| 3300031719|Ga0306917_10790879 | Not Available | 744 | Open in IMG/M |
| 3300031723|Ga0318493_10563564 | Not Available | 633 | Open in IMG/M |
| 3300031751|Ga0318494_10251077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300031771|Ga0318546_10966313 | Not Available | 599 | Open in IMG/M |
| 3300031781|Ga0318547_10607127 | Not Available | 678 | Open in IMG/M |
| 3300031795|Ga0318557_10505426 | Not Available | 555 | Open in IMG/M |
| 3300031805|Ga0318497_10755851 | Not Available | 545 | Open in IMG/M |
| 3300031820|Ga0307473_11554552 | Not Available | 503 | Open in IMG/M |
| 3300031871|Ga0316036_100904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1457 | Open in IMG/M |
| 3300031879|Ga0306919_10349553 | Not Available | 1129 | Open in IMG/M |
| 3300031890|Ga0306925_11321268 | Not Available | 715 | Open in IMG/M |
| 3300031890|Ga0306925_11777099 | Not Available | 592 | Open in IMG/M |
| 3300031891|Ga0316039_108025 | Not Available | 691 | Open in IMG/M |
| 3300031912|Ga0306921_11301027 | Not Available | 804 | Open in IMG/M |
| 3300031946|Ga0310910_11128823 | Not Available | 610 | Open in IMG/M |
| 3300031946|Ga0310910_11493601 | Not Available | 518 | Open in IMG/M |
| 3300031954|Ga0306926_10749841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1180 | Open in IMG/M |
| 3300031956|Ga0316032_100793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1232 | Open in IMG/M |
| 3300032010|Ga0318569_10588605 | Not Available | 518 | Open in IMG/M |
| 3300032043|Ga0318556_10579341 | Not Available | 586 | Open in IMG/M |
| 3300032054|Ga0318570_10148244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300032064|Ga0318510_10445287 | Not Available | 556 | Open in IMG/M |
| 3300032091|Ga0318577_10643587 | Not Available | 503 | Open in IMG/M |
| 3300032515|Ga0348332_10640173 | Not Available | 600 | Open in IMG/M |
| 3300032515|Ga0348332_11642235 | Not Available | 691 | Open in IMG/M |
| 3300032739|Ga0315741_10148529 | Not Available | 1442 | Open in IMG/M |
| 3300032739|Ga0315741_10941102 | Not Available | 765 | Open in IMG/M |
| 3300032805|Ga0335078_10809016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1141 | Open in IMG/M |
| 3300033004|Ga0335084_12294225 | Not Available | 521 | Open in IMG/M |
| 3300033290|Ga0318519_10878846 | Not Available | 553 | Open in IMG/M |
| 3300033829|Ga0334854_111790 | Not Available | 656 | Open in IMG/M |
| 3300034124|Ga0370483_0309598 | Not Available | 545 | Open in IMG/M |
| 3300034199|Ga0370514_153940 | Not Available | 594 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.29% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.84% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.84% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.23% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.23% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.23% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.61% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.61% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004607 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300019164 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019180 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023533 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027166 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030532 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030573 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030577 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030582 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030595 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030603 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030623 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030627 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030631 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030840 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030875 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030907 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031956 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103489651 | 3300001593 | Forest Soil | GALIAIWAVAAVVGAGTWLPWWLLVAIPWIWVMIRRARRHRE* |
| JGI25387J43893_10532652 | 3300002915 | Grasslands Soil | ALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0058882_10221962 | 3300004121 | Forest Soil | MGAWAVVTSALVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE* |
| Ga0068948_10305221 | 3300004607 | Peatlands Soil | IAIWAVAAVIGGGTWFPWWALIAIPWIWAVVRRSQHRRE* |
| Ga0066810_100132513 | 3300005169 | Soil | MGVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0066811_10018423 | 3300005185 | Soil | AAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0070713_1009420781 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0070699_1009596853 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVAIWAVAAVVGGGTWFPWWALIALPWIWAIIRRSQRHGE* |
| Ga0070741_100476829 | 3300005529 | Surface Soil | MVAIWAVAAVVGGGTWFPWWALIALPWIWAIIRRSQHPGS* |
| Ga0070730_110261281 | 3300005537 | Surface Soil | AALVAIWAVAAVIGAGTWIPWWALIVLPWLWITVRHYRPRE* |
| Ga0070733_102475763 | 3300005541 | Surface Soil | ALVAIWAVAAVVGDGTWFPWWALVVLPWIWVLIRRAQHRGE* |
| Ga0070761_103077991 | 3300005591 | Soil | VAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE* |
| Ga0075029_1010521502 | 3300006052 | Watersheds | AIWAVAAVVGGGTWFPWWALIAIPWIWVVVRRSQRPRD* |
| Ga0075029_1013550062 | 3300006052 | Watersheds | WAVVTSALIAIWAVAAVVGGGTWFPWWAVIVIPWIWAVVRRAQRPRE* |
| Ga0074055_100185005 | 3300006573 | Soil | VAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0074056_100182081 | 3300006574 | Soil | AMGVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0066660_108214881 | 3300006800 | Soil | TWAVVTSALVAIWAVAAIVGSGTWFPWWALIALPWIWAIVRRSQRPGD* |
| Ga0099830_107651661 | 3300009088 | Vadose Zone Soil | AVVTSALVAIWAVAAVVGVGTWFPWWALVAIPWIWAVIRRSQRPRE* |
| Ga0116215_14453361 | 3300009672 | Peatlands Soil | MGAWAVVTSALIAIWAVAAVIGGGTWFPWWALIAVPWIWAVVRRSQHRRE* |
| Ga0116217_107955461 | 3300009700 | Peatlands Soil | WAVVTSALIAIWAVAAVIGGGTWFPWWAVIAIPWIWVIVRRSQHRRE* |
| Ga0116217_110199561 | 3300009700 | Peatlands Soil | AWAVVTSALIAIWAVAAVIGGGTWFPWWALIAIPWIWAVVRRSQHRRE* |
| Ga0116219_102793302 | 3300009824 | Peatlands Soil | AIWAVAAVIGVGTWFPWWLLVVIPWTWIMIRRARRDRE* |
| Ga0127471_10095512 | 3300010090 | Grasslands Soil | AVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWVIIRRSQRHGE* |
| Ga0127491_11428942 | 3300010111 | Grasslands Soil | VTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0134063_102811192 | 3300010335 | Grasslands Soil | TSALVAICAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0134071_102437101 | 3300010336 | Grasslands Soil | MGVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIIRRSQRHGE* |
| Ga0126372_101648351 | 3300010360 | Tropical Forest Soil | TSALVAVWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0136449_1038512581 | 3300010379 | Peatlands Soil | LVALWAVALVVGGGTWFPWWALIAIPWIWVVVRRAQRPRE* |
| Ga0126352_10883512 | 3300010859 | Boreal Forest Soil | WAVVTSALVAIWAVAAVVGVGTWFPWWALIAIPWIWAVVRRSQHRRE* |
| Ga0126357_10169013 | 3300010864 | Boreal Forest Soil | WAVVTAALVAIWAVAAVVGVGTWFPWWALIAIPWIWAAIRRAQRPRE* |
| Ga0126359_18204911 | 3300010869 | Boreal Forest Soil | MGAWAVVSSALVAIWAVAAVVGGGTWFPWWALVALPWIWVLIRRAQRPRE* |
| Ga0150983_129059882 | 3300011120 | Forest Soil | ATAALVAIWAVAAVVDGGTWFPWWTVIVLPWIWVLIRGAQRRGE* |
| Ga0150983_159839301 | 3300011120 | Forest Soil | TSALVAIWAVAAVVGGGTWFPWWALVAIPWIWVVIRRAQRPRE* |
| Ga0137392_103522651 | 3300011269 | Vadose Zone Soil | LIAVWAVAAVVGGGTWFPWWAVIAIPWIWAIVRRSQHRGE* |
| Ga0137364_113160202 | 3300012198 | Vadose Zone Soil | AMGVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWVIIRRSQRHGE* |
| Ga0137378_111072381 | 3300012210 | Vadose Zone Soil | SALVAIWAVAAVVGGGTWFPWWALIALPWIWVIIRRSQRHGE* |
| Ga0137378_114626662 | 3300012210 | Vadose Zone Soil | GAWAVVTSALIAIWAVAAVVAGGTWFPWWAVIAIPWIWAIVRRSQHRGE* |
| Ga0150985_1068697761 | 3300012212 | Avena Fatua Rhizosphere | VTSALVAIWAVAAVVGGGTWFPSWALIALPWIWAIVRRSQRHGE* |
| Ga0137387_109451031 | 3300012349 | Vadose Zone Soil | AVTSALVAIWAVAAVVGGGTWFPWWALIAIPWIWAIVRRSQRPGE* |
| Ga0137372_109415982 | 3300012350 | Vadose Zone Soil | MGAWAAVTSALIAIWAVAAVVAGGTWFPWWALVAIPWIWVIVRRSQRHGE* |
| Ga0157328_10101752 | 3300012478 | Arabidopsis Rhizosphere | SALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0157338_10055543 | 3300012515 | Arabidopsis Rhizosphere | AAVTSALVAVWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0126369_104470701 | 3300012971 | Tropical Forest Soil | TSALVAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE* |
| Ga0164309_111790851 | 3300012984 | Soil | MGVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIIRRSQHPGD* |
| Ga0157373_108587352 | 3300013100 | Corn Rhizosphere | SAMVAIWAVAAVVGGGTWFPWWALIALPWIWAIIRRSQHPGD* |
| Ga0181537_100306501 | 3300014201 | Bog | VTGALIAIWAVAAVVGAGTWLPWWLLVAIPWIWVMIRRARRHRE* |
| Ga0182008_104634522 | 3300014497 | Rhizosphere | VAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0182005_10662741 | 3300015265 | Rhizosphere | TSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE* |
| Ga0182036_101161646 | 3300016270 | Soil | SALIAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRNGE |
| Ga0187818_102808281 | 3300017823 | Freshwater Sediment | TLIAIWAVAAVIGVGTWFPWWLLVVIPWTWIMIRRARRDRE |
| Ga0187818_103339112 | 3300017823 | Freshwater Sediment | VGAWAVVTGTLIAIWAVAAVVGVGTWFPWWLLVAIPWIWVLIRRARRNRE |
| Ga0187806_13336341 | 3300017928 | Freshwater Sediment | TLIAIWVVAAVVGVGTWFPWFLLIAIPWIWVMIRRSRRHRE |
| Ga0187783_103470814 | 3300017970 | Tropical Peatland | AVVTSALVAIWAVVAVVAGGTWFPWWALIVLPWIWVLIRRGQHRRE |
| Ga0187781_106500091 | 3300017972 | Tropical Peatland | ALVAIWAVAAVVGGGTWFPWWALVAIPWIWVMIRRSQHPRE |
| Ga0187767_100810121 | 3300017999 | Tropical Peatland | AIGAWGVVTAVIVALWAIADVVGVGTWFPWWAVIVIPWIWVVIRRAQRRE |
| Ga0184582_1280562 | 3300019164 | Soil | VTSALVAVWAVMAVVGSGPWFPWWALIVLPWIGAVIWRTQRRRE |
| Ga0184578_1146713 | 3300019180 | Soil | SALVAIWAVAAVVGVGTWFPWWALIAIPWIWALIRRAQRPRE |
| Ga0184603_1355522 | 3300019192 | Soil | VAFGAWAVVTSALVAIWAVALVVGGGTWFPWWALIAIPWIWAVVRRAQRRGE |
| Ga0187797_14373045 | 3300019284 | Peatland | AIGAWGVVTAVLVALWAVAAVVGVGTWFPWWALIAIPWIWVVIRRAQHRE |
| Ga0210403_105881792 | 3300020580 | Soil | AVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0210403_107109172 | 3300020580 | Soil | LIALWAVAAVIGVGTWLPWWLLVAIPWIWVVIRRARRRGE |
| Ga0210395_113651771 | 3300020582 | Soil | FGAWAVVTSALVAIWAVALVVGGGTWFPWWALIAIPWIWAVVRRAQRRGE |
| Ga0210388_107072991 | 3300021181 | Soil | MGAWATVSAALVAIWAVAAVIGNGTWYPWWALVVVPWLWYMIRHHRPRE |
| Ga0210384_103922841 | 3300021432 | Soil | IAIWAVAAVVGGGTWFPWWAVIAIPWIWAVVRRAQRRGE |
| Ga0210398_115793061 | 3300021477 | Soil | SALIAVWAVLAVIGVGTWFPWWALIAIPWIWVLIRRSQR |
| Ga0210409_101105221 | 3300021559 | Soil | VVTGTLIAIWAVTAVIGVGTWLPWWLLVAIPWIWVLIRRARRRGE |
| Ga0126371_110327583 | 3300021560 | Tropical Forest Soil | WAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0126371_131904621 | 3300021560 | Tropical Forest Soil | VVTGTLIAIWAVAAVVGVGTWLPWWLLIAIPWIWVLIRRARRRREY |
| Ga0213853_115009082 | 3300021861 | Watersheds | VASALVAIWAVAAVVGGGTWFPWWALVVLPWIWVLIRRAQHRGE |
| Ga0242658_10839912 | 3300022530 | Soil | AAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQHRGE |
| Ga0222756_10858602 | 3300022709 | Soil | AAVTGTLIAIWAVTAVIGVGTWIPWWLLVAIPWVWVMIRRAQRHGE |
| Ga0242674_10013271 | 3300022711 | Soil | AVAAVVGVGTWFPWWLLVAIPWIWVMIRRARRHGE |
| Ga0242677_10460482 | 3300022713 | Soil | GVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWVIIRRSQRHGE |
| Ga0242666_10146984 | 3300022721 | Soil | LVAIWAVAAVIGNGTWYPWWALVVVPWLWYMIRHHRPRE |
| Ga0247537_1027131 | 3300023533 | Soil | ALVAIWAVAAVVGVGTWFPWWALIAIPWIWALIRRAQRPRE |
| Ga0247794_100671123 | 3300024055 | Soil | AVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0209152_101831641 | 3300026325 | Soil | VTSALVAVWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0207949_10020045 | 3300026999 | Forest Soil | GTLVAIWAVAAVVGVGTWFPWWLLVAIPWIWVMIRRARRRGE |
| Ga0208729_1025873 | 3300027166 | Forest Soil | ALIALWAVLAVVAGGTWYPWWVLIAVPWIWAAIRRAQRHRE |
| Ga0209008_10692162 | 3300027545 | Forest Soil | MAVGAWAVVTGTLIAIWAVAAVVGVGTWLPWWLLVVIPWIWVMVRRARRHG |
| Ga0209115_10551881 | 3300027567 | Forest Soil | LIAVWAVMAVIGIGNWFPWWALIAIPWIWVLIRRSQR |
| Ga0209447_101804131 | 3300027701 | Bog Forest Soil | VTGTLIALWAVTAVIGAGTWLPWWLLVAIPWIWVMIRRARRRGE |
| Ga0209772_100710611 | 3300027768 | Bog Forest Soil | GTLIALWAVTAVIGAGTWLPWWLLVAIPWIWVMIRRARRRGE |
| Ga0209274_104316821 | 3300027853 | Soil | WAVVTSALVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0209275_107634352 | 3300027884 | Soil | SALIAVWAVLAVIGIGTWFPWWALIAIPWIWVLIRRSQR |
| Ga0209006_103067913 | 3300027908 | Forest Soil | IAIWAVAAVVGVGTWFPWWLLVAIPWIWVMIRRARRRGE |
| Ga0209698_107344061 | 3300027911 | Watersheds | AIWAVAAVVGGGTWFPWWALIAIPWIWVVVRRSQRPGD |
| Ga0209168_103152961 | 3300027986 | Surface Soil | VVTGTLIAIWAVAAVVGVGTWFPWWLLVAIPWIWVMIRRARRRGE |
| Ga0302224_100641133 | 3300028759 | Palsa | TSALVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0302234_105297491 | 3300028773 | Palsa | LVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0302232_100837914 | 3300028789 | Palsa | AWAVVTSALVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0307304_103180201 | 3300028885 | Soil | VTSALVAILAVAAVVGSGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0311340_102007911 | 3300029943 | Palsa | WAVVTSALVALWAVMAVVGTGPWFPWWALIAIPWIWALVRRAQHPRE |
| Ga0311352_113010361 | 3300029944 | Palsa | ALVAIWAVAAVIGGGTWFPWWALVAIPWIWVLIRRAQRPRE |
| Ga0302179_103700102 | 3300030058 | Palsa | MGAWAVVTSALVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0210290_14609991 | 3300030532 | Soil | AVVTSALVAIWAVAAVDGVGTWFPWWALIAIPWIWALVRRAQRPRE |
| Ga0210271_103584802 | 3300030545 | Soil | AVVTSALVAIWAVAAVVGGGTWFPWWALVAIPWIWVLIRRAQRPRE |
| Ga0210272_10126991 | 3300030573 | Soil | LVAIWAVAAVVGVGTWFPWWALIAIPWIWALVRRAQRPRE |
| Ga0210260_100209353 | 3300030577 | Soil | WAVVTSALVAIWAVAAVVGGGTWFPWWALVAIPWIWVVIRRAQRPRE |
| Ga0210275_103228312 | 3300030578 | Soil | VSAALVAIWAVAAVIGNGTWYPWWALVVVPWLWYMIRHHRPRE |
| Ga0210275_103713482 | 3300030578 | Soil | AWAVVTSALVAIWAVAAVVGVGTWFPWWALIAIPWIWALVRRAQRPRE |
| Ga0311355_118180211 | 3300030580 | Palsa | TSALVAIWAVAAVVGGGTWFPWWALVAIPWIWVLIRRAQRPRE |
| Ga0210261_10060211 | 3300030582 | Soil | AAVTGTLIAIWAVTAVVGVGTWIPWWLLVAIPWVWVVIRRAQRHGE |
| Ga0210276_109168941 | 3300030595 | Soil | LVAIWAVAAVVGAGTWFPWWALVAIPWIWVLIRRSQRPRE |
| Ga0210278_10764863 | 3300030596 | Soil | WAVAAVVGAGTWFPWWALVAIPWIWVVIRRSQRPRE |
| Ga0210253_112091091 | 3300030603 | Soil | AVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0311356_102432261 | 3300030617 | Palsa | VALWAVMAVVGTGPWFPWWALIAIPWIWALVRRAQHPRE |
| Ga0265392_12038802 | 3300030623 | Soil | GAWAVVTSALVAIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0210269_100003171 | 3300030627 | Soil | MGAWAVVTGTLIALWAVAAVVGVGTWLPWWLLVAIPWIWVMIRRAQRHGE |
| Ga0210279_104413892 | 3300030631 | Soil | WAVMAVVGTGTWFPWWALIAVPWIWALVRRAQHPRE |
| Ga0265459_126794502 | 3300030741 | Soil | WAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0265461_129561002 | 3300030743 | Soil | AIWAVAAVVGAGTWFPWWALVAIPWIWVVIRRSQRPRE |
| Ga0265461_138716381 | 3300030743 | Soil | VSSALVAIWAVAAVVGGGTWFPWWALVALPWIWVLIRRAQRPRE |
| Ga0265763_10408062 | 3300030763 | Soil | GAWAVVTSALVAIWAVALVVGGGTWFPWWALIAIPWIWAVVRRAQRRGE |
| Ga0265763_10569172 | 3300030763 | Soil | GVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0074020_112647511 | 3300030840 | Soil | VTSALVAIWAVAAVVGVGTWFPWWALIAIPWIWALIRRAQRPRE |
| Ga0265727_1034182 | 3300030875 | Soil | WAVVTSALVAIWAVAAVAGGTWFPWWALIALPWIWVLIRRAQHRRE |
| Ga0265764_1005601 | 3300030882 | Soil | SALVAIWAVALVVGGGTWFPWWALIAIPWIWAVVRRAQRRGE |
| Ga0074013_118524381 | 3300030907 | Soil | LWAVMAVVGTGTWFPWWALIAIPWIWALVRRAQHPRE |
| Ga0265754_10191052 | 3300031040 | Soil | ALVAIWAVALVVGGGTWFPWWALIAIPWIWAVVRRAQRRGE |
| Ga0265779_1044283 | 3300031043 | Soil | AVAAVIGGGTWFPWWAVIAIPWIWVVIRRAQHPRD |
| Ga0170824_1218948191 | 3300031231 | Forest Soil | ALIAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE |
| Ga0170820_124352911 | 3300031446 | Forest Soil | MGVWAAVTSALVAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQHRGE |
| Ga0170820_140138011 | 3300031446 | Forest Soil | TSALVAIWAVAAVVGTGTWFPWWALIAIPWIWAIVRRSQRPGE |
| Ga0318516_105968751 | 3300031543 | Soil | VTSALIAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRNGE |
| Ga0318571_101066583 | 3300031549 | Soil | AWAVVTGTLIAIWAVAAVVGVGTWLPWWLLIAIPWIWVLIRRAQRRGE |
| Ga0318573_105584342 | 3300031564 | Soil | WAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRNGE |
| Ga0318542_107432112 | 3300031668 | Soil | IAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE |
| Ga0318496_103400751 | 3300031713 | Soil | IWAVAAVVGGGTWFPWWALIAIPWIWAIVRRSQRPGE |
| Ga0307476_103968681 | 3300031715 | Hardwood Forest Soil | AVTGTLIAIWAVTAVIGVGTWIPWWLLVAIPWVWVMIRRAQRHGE |
| Ga0306917_107908792 | 3300031719 | Soil | GAWAVVTGTLIAIWAVMAVVGAGTWLPWWLLIAIPWLWVLIRRAQRHGE |
| Ga0318493_105635642 | 3300031723 | Soil | AALVAIWAVAAVIGGGTWFPWWALVAIPWIWVVIRRAQRPRE |
| Ga0318494_102510771 | 3300031751 | Soil | AVAAVAGVGTWLPWWLLVVIPWTWVMIRRARRGRE |
| Ga0318546_109663131 | 3300031771 | Soil | AWAVVTGTLIAIWAVLAVVGVGTWLPWWLLIAIPWLWVLIRRARGRE |
| Ga0318547_106071272 | 3300031781 | Soil | VTSALVAIWAVVAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE |
| Ga0318557_105054261 | 3300031795 | Soil | VVTGTLIAIWAVMAVVGAGTWLPWWLLIAIPWLWVLIRRAQRHGE |
| Ga0318497_107558512 | 3300031805 | Soil | AVGAWAVVTGTLIAIWAVAAVVGVGTWLPWWLLIAIPWIWVLIRRARRRGE |
| Ga0307473_115545521 | 3300031820 | Hardwood Forest Soil | VAVWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0316036_1009044 | 3300031871 | Soil | VTSALVAIWAVAAVAGGTWFPWWALIALPWIWVLIRRAQHRRE |
| Ga0306919_103495531 | 3300031879 | Soil | WGVVTAALVAIWAVAAVIGGGTWFPWWALVAIPWIWVVIRRAQRPRE |
| Ga0306925_113212682 | 3300031890 | Soil | TSALIAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE |
| Ga0306925_117770991 | 3300031890 | Soil | VAVWAVAAVVGGGTWFPWWALIAIPWIWVVVRRSQRPRD |
| Ga0316039_1080252 | 3300031891 | Soil | AVVTSALVAIWAVAAVAGGTWFPWWALIALPWIWVLIRRAQHRRE |
| Ga0306921_113010272 | 3300031912 | Soil | VGAWAVVTGTLIAIWAVMAVVGAGTWLPWWLLIAIPWLWVLIRRAQRHGE |
| Ga0310910_111288232 | 3300031946 | Soil | WAVVTSVLVAVWAVAAVVGGGTWFPWWALIAIPWIWVVVRRSQRPRD |
| Ga0310910_114936012 | 3300031946 | Soil | GVVTAALVAIWAVAAVIGGGTWFPWWALVAIPWIWVVIRRAQRPRE |
| Ga0306926_107498411 | 3300031954 | Soil | AIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE |
| Ga0316032_1007931 | 3300031956 | Soil | SALVAIWAVAAVAGGTWFPWWALIALPWIWVLIRRAQHRRE |
| Ga0318569_105886051 | 3300032010 | Soil | VGAWAVVTGTLIAIWAVMAVIGVGTWLPWWLLIAIPWIWVLIRRARRSGE |
| Ga0318556_105793411 | 3300032043 | Soil | AWGVVTAALVAIWAVAAVIGGGTWFPWWALVAIPWIWVVIRRAQRPRE |
| Ga0318570_101482444 | 3300032054 | Soil | GVWAAATSALIAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE |
| Ga0318510_104452872 | 3300032064 | Soil | IWAVLAVVGVGTWLPWWLLIAIPWLWVLIRRARGRE |
| Ga0318577_106435872 | 3300032091 | Soil | WAAVTSALIAIWAVAAVVGGGTWFPWWALIALPWIWVIVRRSQRHGE |
| Ga0348332_106401731 | 3300032515 | Plant Litter | LGAWGAVSAALVAIWAVAAVIGGGTWFPWWALVAIPWIWVVIRRAQRPCE |
| Ga0348332_116422352 | 3300032515 | Plant Litter | AVVTGTLIAIWAVAAVIGVGTWLPWWLLVAIPWMWELIRRARRRGE |
| Ga0315741_101485291 | 3300032739 | Forest Soil | VTSALVAIWAVAAVVGVGTWFPWWALIAIPWIWVLIRRSQR |
| Ga0315741_109411021 | 3300032739 | Forest Soil | AIWAVAAVVGGGTWFPWWALIAIPWIWVLIRRAQRPRE |
| Ga0335078_108090164 | 3300032805 | Soil | IAIWAVAAVVGVGTWFPWWLLVVIPWTWIMIRRARRGRE |
| Ga0335084_122942251 | 3300033004 | Soil | VAIWAVAAVVGGGTWFPWWALIALPWIWAIVRRSQRHGE |
| Ga0318519_108788461 | 3300033290 | Soil | IWAVAAVIGGGTWFPWWALVAIPWIWVVIRRAQRPRE |
| Ga0334854_111790_459_611 | 3300033829 | Soil | MGAWGVVTGALIAIWAVAAVVGAGTWLPWWLLVAIPWIWVMIRRARRHGE |
| Ga0370483_0309598_4_141 | 3300034124 | Untreated Peat Soil | VVTSALVAIWAVAAVVGVGTWFPWWALVAIPWVWALIRRAQRPRE |
| Ga0370514_153940_18_152 | 3300034199 | Untreated Peat Soil | VTSALVALWAVMAVVGTGTWFPWWALIAIPWIWALVRRAQHPRE |
| ⦗Top⦘ |