Scaffold Ga0150983_10900058

Overview

Basic Information

• Taxon OID: 3300011120
• Scaffold ID: Ga0150983_10900058
• Source Dataset Name: Combined assembly of Microbial Forest Soil metaT
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 527
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location

• Location Name: Harvard Forest LTER, Petersham, MA, USA
• Coordinates
  • Lat. (^o): 42.532967
  • Long. (^o): -72.180244
  • Depth (m): 0 to .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038345	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0150983_109000583	F038345	AGCAGG	METILGFVAGYLVGTRDGKDGLERMRSSLHSIRTSPEVRKLAADAI