Scaffold Ga0151466_1103982

Overview

Basic Information

• Taxon OID: 3300011102
• Scaffold ID: Ga0151466_1103982
• Source Dataset Name: Composted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant re-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Sao Paulo State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 680
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant → Composted Filter Cake Microbial Communities From Nova Europa, Brazil, From A Cane Sugar Milling Plant

Source Dataset Sampling Location

• Location Name: Nova Europa, Brazil
• Coordinates
  • Lat. (^o): -21.818963
  • Long. (^o): -48.614275
  • Depth (m): .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088752	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0151466_11039821	F088752	AGGA	MKGLQSVYNQITNILKENNVLMNITPPRPYLIKKDDEERINAEAEDLFKKCKIEEYNSKMKEKEAYKLYFDEAYKYTNFYEEGDE*