NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139299_1047778

Scaffold Ga0139299_1047778


Overview

Basic Information
Taxon OID3300011007 Open in IMG/M
Scaffold IDGa0139299_1047778 Open in IMG/M
Source Dataset NameBasal ice microbial communities from Matanuska glacier, Alaska, USA - MataB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterTsinghua University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1066
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice → Basal Ice Microbial Communities From Matanuska Glacier, Alaska, Usa - Matab

Source Dataset Sampling Location
Location NameMatanuska glacier, Alaska, USA
CoordinatesLat. (o)61.6558Long. (o)147.5811Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090348Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0139299_10477782F090348N/AMMAASPINDRWQADMARLIDPCTDPATGFHRRLEEVFRLD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.