| Basic Information | |
|---|---|
| Family ID | F090348 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ASPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.78 % |
| % of genes near scaffold ends (potentially truncated) | 91.67 % |
| % of genes from short scaffolds (< 2000 bps) | 92.59 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.926 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.037 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.296 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.815 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 3.08% Coil/Unstructured: 76.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00370 | FGGY_N | 12.04 |
| PF02782 | FGGY_C | 7.41 |
| PF00596 | Aldolase_II | 6.48 |
| PF01261 | AP_endonuc_2 | 4.63 |
| PF05336 | rhaM | 4.63 |
| PF05448 | AXE1 | 4.63 |
| PF12833 | HTH_18 | 3.70 |
| PF00128 | Alpha-amylase | 1.85 |
| PF13407 | Peripla_BP_4 | 1.85 |
| PF13823 | ADH_N_assoc | 1.85 |
| PF02311 | AraC_binding | 1.85 |
| PF02424 | ApbE | 1.85 |
| PF00092 | VWA | 1.85 |
| PF08240 | ADH_N | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF00480 | ROK | 0.93 |
| PF05592 | Bac_rhamnosid | 0.93 |
| PF04945 | YHS | 0.93 |
| PF01594 | AI-2E_transport | 0.93 |
| PF00313 | CSD | 0.93 |
| PF00801 | PKD | 0.93 |
| PF00676 | E1_dh | 0.93 |
| PF13180 | PDZ_2 | 0.93 |
| PF07681 | DoxX | 0.93 |
| PF13602 | ADH_zinc_N_2 | 0.93 |
| PF01019 | G_glu_transpept | 0.93 |
| PF04075 | F420H2_quin_red | 0.93 |
| PF10944 | DUF2630 | 0.93 |
| PF06224 | HTH_42 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.63 |
| COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 4.63 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 4.63 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.85 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 1.85 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.85 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.85 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 1.85 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.85 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.93 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.93 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.93 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.93 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.93 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.93 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.93 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.93 % |
| Unclassified | root | N/A | 24.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918008|ConsensusfromContig369035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii | 772 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100170321 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108945559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
| 3300001870|JGI24129J20441_1042454 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300002066|JGIcombinedJ21911_10052951 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10040778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2096 | Open in IMG/M |
| 3300002549|JGI24130J36418_10027647 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300004079|Ga0055514_10048043 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300004081|Ga0063454_100464652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 875 | Open in IMG/M |
| 3300004156|Ga0062589_102287881 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300004808|Ga0062381_10252573 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005353|Ga0070669_101994014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300005356|Ga0070674_100624806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300005440|Ga0070705_101515517 | Not Available | 562 | Open in IMG/M |
| 3300005466|Ga0070685_10941457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300005468|Ga0070707_101070196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
| 3300005535|Ga0070684_101414366 | Not Available | 655 | Open in IMG/M |
| 3300005764|Ga0066903_101685818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1206 | Open in IMG/M |
| 3300005980|Ga0066798_10056919 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006605|Ga0074057_11148244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 688 | Open in IMG/M |
| 3300006853|Ga0075420_101852258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300009081|Ga0105098_10492216 | Not Available | 623 | Open in IMG/M |
| 3300009147|Ga0114129_12864111 | Not Available | 571 | Open in IMG/M |
| 3300009148|Ga0105243_11001981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 838 | Open in IMG/M |
| 3300009167|Ga0113563_11687748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300009551|Ga0105238_12769939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300010359|Ga0126376_13059767 | Not Available | 517 | Open in IMG/M |
| 3300010371|Ga0134125_12132115 | Not Available | 609 | Open in IMG/M |
| 3300010373|Ga0134128_11277311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300010373|Ga0134128_12167093 | Not Available | 612 | Open in IMG/M |
| 3300011007|Ga0139299_1047778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1066 | Open in IMG/M |
| 3300011408|Ga0137460_1108311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300012093|Ga0136632_10312835 | Not Available | 706 | Open in IMG/M |
| 3300012212|Ga0150985_109103862 | Not Available | 525 | Open in IMG/M |
| 3300012960|Ga0164301_10488281 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012986|Ga0164304_10901047 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012987|Ga0164307_11309880 | Not Available | 606 | Open in IMG/M |
| 3300012988|Ga0164306_10836233 | Not Available | 744 | Open in IMG/M |
| 3300013096|Ga0157307_1077227 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 671 | Open in IMG/M |
| 3300013296|Ga0157374_10548674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1163 | Open in IMG/M |
| 3300013296|Ga0157374_11180357 | Not Available | 787 | Open in IMG/M |
| 3300013297|Ga0157378_10530818 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300013308|Ga0157375_13290873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Yonghaparkia | 539 | Open in IMG/M |
| 3300014325|Ga0163163_10465337 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300014498|Ga0182019_10004474 | All Organisms → cellular organisms → Bacteria | 7213 | Open in IMG/M |
| 3300014502|Ga0182021_10110103 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
| 3300014502|Ga0182021_10187691 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300014745|Ga0157377_10233730 | Not Available | 1183 | Open in IMG/M |
| 3300014745|Ga0157377_10588630 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300014875|Ga0180083_1018093 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300015077|Ga0173483_10021461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2283 | Open in IMG/M |
| 3300015200|Ga0173480_10247793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 969 | Open in IMG/M |
| 3300015201|Ga0173478_10726134 | Not Available | 535 | Open in IMG/M |
| 3300017695|Ga0180121_10139272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 885 | Open in IMG/M |
| 3300017941|Ga0187850_10434525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii | 571 | Open in IMG/M |
| 3300017998|Ga0187870_1115696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii | 1017 | Open in IMG/M |
| 3300018028|Ga0184608_10294420 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300018055|Ga0184616_10395261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300018071|Ga0184618_10366498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
| 3300018077|Ga0184633_10348970 | Not Available | 747 | Open in IMG/M |
| 3300018084|Ga0184629_10538558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
| 3300019257|Ga0180115_1232079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300023077|Ga0247802_1080783 | Not Available | 548 | Open in IMG/M |
| 3300023311|Ga0256681_10966159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii | 910 | Open in IMG/M |
| 3300025692|Ga0209744_1048137 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300025711|Ga0207696_1165859 | Not Available | 587 | Open in IMG/M |
| 3300025716|Ga0209746_1061465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii | 1234 | Open in IMG/M |
| 3300025846|Ga0209538_1350703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300025885|Ga0207653_10340645 | Not Available | 585 | Open in IMG/M |
| 3300025888|Ga0209540_10654640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300025908|Ga0207643_11002199 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 540 | Open in IMG/M |
| 3300025935|Ga0207709_10189114 | Not Available | 1461 | Open in IMG/M |
| 3300025944|Ga0207661_11583408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300025980|Ga0210137_1062779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300026116|Ga0207674_10977888 | Not Available | 815 | Open in IMG/M |
| 3300026142|Ga0207698_11512546 | Not Available | 687 | Open in IMG/M |
| 3300026142|Ga0207698_12019906 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300026142|Ga0207698_12242134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300026324|Ga0209470_1042260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2246 | Open in IMG/M |
| 3300027841|Ga0209262_10216836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 927 | Open in IMG/M |
| 3300027887|Ga0208980_10623150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300027896|Ga0209777_10287650 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300028556|Ga0265337_1158903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300028577|Ga0265318_10073679 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300028654|Ga0265322_10033094 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300028796|Ga0307287_10176053 | Not Available | 813 | Open in IMG/M |
| 3300028802|Ga0307503_10074156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1378 | Open in IMG/M |
| 3300028814|Ga0307302_10694384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300028828|Ga0307312_10805115 | Not Available | 623 | Open in IMG/M |
| 3300028855|Ga0302257_1006221 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
| 3300028885|Ga0307304_10322958 | Not Available | 686 | Open in IMG/M |
| 3300029990|Ga0311336_10114502 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300030002|Ga0311350_10592854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 996 | Open in IMG/M |
| 3300030114|Ga0311333_10807953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii | 787 | Open in IMG/M |
| 3300030294|Ga0311349_12141535 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300030339|Ga0311360_10936996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 685 | Open in IMG/M |
| 3300031235|Ga0265330_10116793 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300031726|Ga0302321_101531394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 769 | Open in IMG/M |
| 3300031833|Ga0310917_10459104 | Not Available | 867 | Open in IMG/M |
| 3300031854|Ga0310904_10389812 | Not Available | 909 | Open in IMG/M |
| 3300031873|Ga0315297_10834546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 767 | Open in IMG/M |
| 3300031902|Ga0302322_103044734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300031997|Ga0315278_11604257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300032008|Ga0318562_10363776 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300032397|Ga0315287_11437976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 782 | Open in IMG/M |
| 3300034123|Ga0370479_0263372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300034195|Ga0370501_0367033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14 | 525 | Open in IMG/M |
| 3300034257|Ga0370495_0031055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.04% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.41% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.70% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.78% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 2.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.78% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.85% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.93% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| Basal Ice | Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
| 3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
| 3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011007 | Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025716 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025980 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028855 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Bog_all_C_01802320 | 2140918008 | Soil | RFRTMMDEAPVNARWQAEMAALIDPCIDPATGFHRRLDEVFHLD |
| JGIcombinedJ13530_1001703211 | 3300001213 | Wetland | AHMAAQEVNDRWQADMTRLIDPCTDPATGFHRRLEEIFRLD* |
| JGIcombinedJ13530_1089455591 | 3300001213 | Wetland | SMAAAPVNDRWQADMARLIDPCTDPATGFHRRLEEVFRLD* |
| JGI24129J20441_10424542 | 3300001870 | Arctic Peat Soil | VNARWQADMAALIDPCTDPATGFHRRLDEVFRLD* |
| JGIcombinedJ21911_100529512 | 3300002066 | Arctic Peat Soil | PVNARWQADMAALIDPCTDPATGFHRRLDEVFRLD* |
| JGIcombinedJ21912_100407783 | 3300002069 | Arctic Peat Soil | LDFDRFRAMMDVSPVNARWQADMAALIDPCTDPATGFHRRLDEVFRLD* |
| JGI24130J36418_100276472 | 3300002549 | Arctic Peat Soil | RFRAMMDVSPVNARWQADMAALIDPCTDPATGFHRRLDEVFRLD* |
| Ga0055514_100480432 | 3300004079 | Natural And Restored Wetlands | RAHMAAQPVNDRWQAEMTRLIDPCTDPATGFHRRLEEVFRLD* |
| Ga0063454_1004646521 | 3300004081 | Soil | FRRHMAASAVNERWQHEMQALIDPLTDPETGFHRRLDEVFHLE* |
| Ga0062589_1022878811 | 3300004156 | Soil | FRVSMAAAPINERWQAEMAALIDPLTDPTTGFHQRLEEIFHLD* |
| Ga0062381_102525732 | 3300004808 | Wetland Sediment | FRAHMAAQPVNDRWQADMARLIDPCTDPATGFHRRLEEVFRLD* |
| Ga0070669_1019940141 | 3300005353 | Switchgrass Rhizosphere | VDDFAAFTTAMADSEANARWQEEMAALIDPLTDPATGFHRRLDEVFHLG* |
| Ga0070674_1006248062 | 3300005356 | Miscanthus Rhizosphere | YLEVEDLGRFQQHMNDSEVNARWQAHMGVLIDPLTDPATGFHRRLDEVFHLE* |
| Ga0070705_1015155172 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RYMAASAVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLG* |
| Ga0070685_109414571 | 3300005466 | Switchgrass Rhizosphere | TAFTEAMATSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE* |
| Ga0070707_1010701961 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANPVNDRWQAEMAALIDPLTDPETGFHQRLEEIFHLD* |
| Ga0070684_1014143662 | 3300005535 | Corn Rhizosphere | HLADSPVNARWQAEMGVLIDPLTDPATGFHRQLDEVFHLG* |
| Ga0066903_1016858181 | 3300005764 | Tropical Forest Soil | ASEVNARWQASMGVLIDPLTDPETGFHQQLDEVFHLA* |
| Ga0066798_100569192 | 3300005980 | Soil | GSFRAMMDAAPVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD* |
| Ga0074057_111482443 | 3300006605 | Soil | DDFDRFRAMMDASPVNARWQAEMADLIDPMIDPATGFHQRLDEIFRLD* |
| Ga0075420_1018522582 | 3300006853 | Populus Rhizosphere | GSAANARWQTEMAELIDPLTDPDTGFHRRIPEVFHLE* |
| Ga0105098_104922161 | 3300009081 | Freshwater Sediment | DRFRALMDAAPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD* |
| Ga0114129_128641111 | 3300009147 | Populus Rhizosphere | TAVNDRWQADMAALIDPLTDPATGFHRRLEEVFHLE* |
| Ga0105243_110019811 | 3300009148 | Miscanthus Rhizosphere | AAFRAHLAESAVNARWQAEMGDLIDPLTDPATGFHRQLDEVFHLD* |
| Ga0113563_116877482 | 3300009167 | Freshwater Wetlands | VNARWQAEMAALIDPCTDPATGFHRRLEEVFHLD* |
| Ga0105238_127699391 | 3300009551 | Corn Rhizosphere | TTMAAAPINGPWQADMAPLIDPLTDPATGFHRRLDEVFHLD* |
| Ga0126376_130597671 | 3300010359 | Tropical Forest Soil | SDANRRWQPDMASLIDPLTDPDTGFHHRMREVFHLD* |
| Ga0134125_121321151 | 3300010371 | Terrestrial Soil | VNDRWQAEMAALIDPLTDPATGFHHRLEEIFHLD* |
| Ga0134128_112773111 | 3300010373 | Terrestrial Soil | NPVNDRWQADMASLIDPLTDPATGFHRRLDEVFHLD* |
| Ga0134128_121670931 | 3300010373 | Terrestrial Soil | ASTVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLG* |
| Ga0139299_10477782 | 3300011007 | Basal Ice | MMAASPINDRWQADMARLIDPCTDPATGFHRRLEEVFRLD* |
| Ga0137460_11083112 | 3300011408 | Soil | DDFDRFRRLMDASSVNARWQAEMAGLIDPCTDPATGFHRRLEEVFRLD* |
| Ga0136632_103128352 | 3300012093 | Polar Desert Sand | LEVEDFDRFRRHMSASQVNERWQADMAGLIDPMTDPDTGFHRRLDEVFRL* |
| Ga0150985_1091038621 | 3300012212 | Avena Fatua Rhizosphere | ESDANERWQPEMASLIDPLTDADTGFHHRMREVFHLD* |
| Ga0164301_104882812 | 3300012960 | Soil | AFRAYLAESAVNARWQAEMGDLIDPLTDAATGFHRQLDEVFHLD* |
| Ga0164304_109010471 | 3300012986 | Soil | FARFREQMAAAEINDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD* |
| Ga0164307_113098802 | 3300012987 | Soil | GHSDANERWQAEMASLIDPLTDPATGFHQRLEEVFHLD* |
| Ga0164306_108362331 | 3300012988 | Soil | AFRSAMAAAPVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD* |
| Ga0157307_10772272 | 3300013096 | Soil | VDDFTAFTEAMATSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE* |
| Ga0157374_105486741 | 3300013296 | Miscanthus Rhizosphere | SDVNARWQASMGVLIDPLTDPATGFHQQLDEVFHLE* |
| Ga0157374_111803572 | 3300013296 | Miscanthus Rhizosphere | MAATPVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD* |
| Ga0157378_105308184 | 3300013297 | Miscanthus Rhizosphere | PVNDRWQADMAPLIDPLIDPSTGFHRRLDEVFHLD* |
| Ga0157375_132908731 | 3300013308 | Miscanthus Rhizosphere | MAASPVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD* |
| Ga0163163_104653371 | 3300014325 | Switchgrass Rhizosphere | TEVNDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD* |
| Ga0182019_1000447410 | 3300014498 | Fen | MDEAPINAPWQAEMAALIDPCIDPATGFHRRLDEVFRLD* |
| Ga0182021_101101031 | 3300014502 | Fen | MDAAPANARWQAEMTSLIDPCIDPATGFHGRLDEVFHLD* |
| Ga0182021_101876913 | 3300014502 | Fen | FERFRKMMDEAPINAPWQAEMAALIDPCIDPATGFHRRLDEVFRLD* |
| Ga0157377_102337302 | 3300014745 | Miscanthus Rhizosphere | MADSEANARWQEEMAALIDPLTDPATGFHRRLDEVFHLG* |
| Ga0157377_105886302 | 3300014745 | Miscanthus Rhizosphere | NDSEVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLE* |
| Ga0180083_10180931 | 3300014875 | Soil | RTIMDAAPVNARWQAEMTSLIDPCTDPATGFHRRLEEVFRLD* |
| Ga0173483_100214613 | 3300015077 | Soil | FTAAMAESEANAHWQAEMAALIDPLTDPATGFHRRLDEVFHLE* |
| Ga0173480_102477933 | 3300015200 | Soil | DFERFRTYMAASEVNSRWQAEMGDGLIDPLTDPATGFHQRLDEVFHLD* |
| Ga0173478_107261342 | 3300015201 | Soil | DDFARSREYMAAQAVNDRWQSEMAELIDPLTDPATGFHQRLEEIFHLD* |
| Ga0180121_101392721 | 3300017695 | Polar Desert Sand | MAASPVNERWQADMASLIDARTDPTTGFHERLVEVFHLD |
| Ga0187850_104345252 | 3300017941 | Peatland | DAAPVNARWQADMAALIDPCVDPATGFHRRLDEVFRLD |
| Ga0187870_11156961 | 3300017998 | Peatland | DDFARFRSMMDGAPVNARWQAEMTSLIDPCIDPATGFHRRIDEVFRLD |
| Ga0184608_102944202 | 3300018028 | Groundwater Sediment | ASPVNARWQSEMAALIDPLTDPATGFHERLAEVFHLD |
| Ga0184616_103952612 | 3300018055 | Groundwater Sediment | FEVDDFDRFRTMMDAAPVNARWQAEMTSLIDPCTDPATGFHRRLEEVFRLD |
| Ga0184618_103664982 | 3300018071 | Groundwater Sediment | EVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD |
| Ga0184633_103489701 | 3300018077 | Groundwater Sediment | AASPVNARWQAEMGHLIDPLTNPSTGFHQRLEEIFHLD |
| Ga0184629_105385581 | 3300018084 | Groundwater Sediment | DFAAFRATVAASPVNDRWQGEMAVLIDPLTDPATGFHQRLEEIFHLD |
| Ga0180115_12320791 | 3300019257 | Groundwater Sediment | MAAAPVNARWQAEMATLIDPCTDPATGFHRRLDEVFRLD |
| Ga0247802_10807831 | 3300023077 | Soil | EVNARWQSDMGILIDPLTDPATGFHRQLDEVFHLE |
| Ga0256681_109661591 | 3300023311 | Freshwater | FGVLEVDDFERFRKMMDEAPINGPWQAEMTALIDPCIDPSTGFHRRLDEVFRLD |
| Ga0209744_10481372 | 3300025692 | Arctic Peat Soil | VLDFDRFRAMMDASPVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD |
| Ga0207696_11658592 | 3300025711 | Switchgrass Rhizosphere | AATEVIDRWQAEMAALIDPLTDPATGFHRQLEEIFHLE |
| Ga0209746_10614653 | 3300025716 | Arctic Peat Soil | APINAPWQAEIASLIDPCTDPATGFHRRLDEVFRLD |
| Ga0209538_13507032 | 3300025846 | Arctic Peat Soil | DRFRAMMDASSVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD |
| Ga0207653_103406451 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | TAMAATEVNDRWQADMAALIDPQTDPATGFHRRLDEVFHLE |
| Ga0209540_106546402 | 3300025888 | Arctic Peat Soil | EVNARWQADMASLIDPCTDPATGFHRRLDEVFRLD |
| Ga0207643_110021991 | 3300025908 | Miscanthus Rhizosphere | ADSEANARWQEEMAALIDPLTDPATGFHRRLDEVFHLG |
| Ga0207709_101891142 | 3300025935 | Miscanthus Rhizosphere | EAMATSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE |
| Ga0207661_115834082 | 3300025944 | Corn Rhizosphere | HMNDSAVNARWQADMGVLIDPLTDPETGFHRQLDEVFHLE |
| Ga0210137_10627792 | 3300025980 | Natural And Restored Wetlands | RAHMAAQPVNDRWQAEMTRLIDPCTDPATGFHRRLEEVFRLD |
| Ga0207674_109778881 | 3300026116 | Corn Rhizosphere | FTSQMAGSDANARWQAEMAELIDPLTDPATGFHTRISEVFHLD |
| Ga0207698_115125462 | 3300026142 | Corn Rhizosphere | TEINDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD |
| Ga0207698_120199062 | 3300026142 | Corn Rhizosphere | FQRHMNESEVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLD |
| Ga0207698_122421342 | 3300026142 | Corn Rhizosphere | MSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE |
| Ga0209470_10422602 | 3300026324 | Soil | MSSQEVNDRWQAGMTALIDPLTDPETGFHRRLEEVFHLE |
| Ga0209262_102168361 | 3300027841 | Freshwater | FEVEDFDRFRRLMDAAPINARWQAEMAALIDPCTDPATGFHRRLEEVFRLE |
| Ga0208980_106231502 | 3300027887 | Wetland | RLMDGSPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLE |
| Ga0209777_102876501 | 3300027896 | Freshwater Lake Sediment | MMDASPVNASWQADMASLIDPCTDPATGFHRRLEEVFRLD |
| Ga0265337_11589031 | 3300028556 | Rhizosphere | PINAPWQADMAALIDPCTDPATGFHRRLEEIFHLD |
| Ga0265318_100736791 | 3300028577 | Rhizosphere | AMAASPVDARWQTEMTALINPLIDPATGFHRRLEEIFHLE |
| Ga0265322_100330942 | 3300028654 | Rhizosphere | RALMDAAPVNARWQAEMALLIDQCTDPETGFHRRLDEVFRLD |
| Ga0307287_101760532 | 3300028796 | Soil | FREHMAATEVNDRWQAEMATLIDPLTDPATGFHQRLEEIFHLD |
| Ga0307503_100741561 | 3300028802 | Soil | ASMAAAPVNDRWQADMASLIDPLTDPTTGFHQRLEEIFHLD |
| Ga0307302_106943842 | 3300028814 | Soil | PVNALWQADMAELIDPLIDPSTGFHQRLDEVFRLG |
| Ga0307312_108051152 | 3300028828 | Soil | AAPVNDRWQAEMAALIDPLTDPATGFHQRLEEIFHLE |
| Ga0302257_10062211 | 3300028855 | Fen | MMDEAPINAPWQAEMAALIDPCIDPATGFHRRLDEVFRLD |
| Ga0307304_103229581 | 3300028885 | Soil | REQMAATEINDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD |
| Ga0311336_101145021 | 3300029990 | Fen | HFRALMDASEVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD |
| Ga0311350_105928541 | 3300030002 | Fen | FDVEDFDRFRAHMAAQGVNDRWQADMARLIDPCTDPATGFHRRLDEVFRLD |
| Ga0311333_108079532 | 3300030114 | Fen | LVVDDFDRFRKMMDEAPINAPWQAEMAALIDPCIDPATGFHGRLDEVFHLD |
| Ga0311349_121415351 | 3300030294 | Fen | SPVNDRWQADMAGLIDPCTDPATGFHRRLDEVFRLD |
| Ga0311360_109369961 | 3300030339 | Bog | AVNTRWQAEMGSSLIDPLTDPATGFHRQLDEVFHLA |
| Ga0265330_101167932 | 3300031235 | Rhizosphere | SPVDARWQTEMTALINPLIDPATGFHRRLEEIFHLE |
| Ga0302321_1015313941 | 3300031726 | Fen | AALEVNDRWQADMARLIDPCTDPDTGFHRRLDEVFRLD |
| Ga0310917_104591041 | 3300031833 | Soil | RFQAYLAASDVNARWQASMGVLIDPMTDPATGFHHQLDEVFHLD |
| Ga0310904_103898122 | 3300031854 | Soil | DRFTQHMAGSAANARWQTEMAELIDPLTDPDTGFHRRIPEVFHLE |
| Ga0315297_108345461 | 3300031873 | Sediment | ASPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD |
| Ga0302322_1030447341 | 3300031902 | Fen | NRFRTLMDAAPVNARWQAEMASLIDPCTDPATGFHRRLEEVFRLD |
| Ga0315278_116042571 | 3300031997 | Sediment | PINARWQAEMAALIDPCTDPATGFHRRLEEVFRLD |
| Ga0318562_103637763 | 3300032008 | Soil | FRATMDASPVNARWQADMGRLIDPLTDASTGFHQRLDEVFHLD |
| Ga0315287_114379761 | 3300032397 | Sediment | PVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD |
| Ga0370479_0263372_354_500 | 3300034123 | Untreated Peat Soil | EDFDAFRAHMAAQPVNTRWQADMERLIDPCTDPATGFHRRLDEVFRFD |
| Ga0370501_0367033_395_514 | 3300034195 | Untreated Peat Soil | MAASQVDARWQAEMAGLIDPLTDPNTGFHERLDEVFHLD |
| Ga0370495_0031055_281_418 | 3300034257 | Untreated Peat Soil | MERVAHMAAQPVNDRWQADMARLIDPCTDPATGFHRRLEEVFRLD |
| ⦗Top⦘ |