Scaffold Ga0138513_100053821

Overview

Basic Information

• Taxon OID: 3300011000
• Scaffold ID: Ga0138513_100053821
• Source Dataset Name: Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 612
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: Ranch near Red Deer, Alberta, Canada
• Coordinates
  • Lat. (^o): 52.172047
  • Long. (^o): -113.738964
  • Depth (m): .15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042600	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138513_1000538211	F042600	N/A	MSIYELDISWAITADERRRLHWQLIVSDEVSGVFLTARDDVLAILFSGDHKGFDALARTLAPETLGTAE*