Basic Information | |
---|---|
Taxon OID | 3300011000 Open in IMG/M |
Scaffold ID | Ga0138513_100012509 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1083 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ranch near Red Deer, Alberta, Canada | |||||||
Coordinates | Lat. (o) | 52.172047 | Long. (o) | -113.738964 | Alt. (m) | Depth (m) | .15 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101518 | Metagenome / Metatranscriptome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138513_1000125092 | F101518 | N/A | VLCAIDTTQAFAQHEVSQQLLELEEADRNTFFTMQLRGSNKRCDQVIRTLFNAAYLDVDEWEALCRDHNSYSLNVPADPDATITSLHCRELSTTSKMLLQSVGSKNKASGCRIKGERRKRH* |
⦗Top⦘ |