| Basic Information | |
|---|---|
| Taxon OID | 3300010993 Open in IMG/M |
| Scaffold ID | Ga0139329_141133 Open in IMG/M |
| Source Dataset Name | ECM15MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 503 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Louisiana, Port Sulphur, Bay Sansbois east | |||||||
| Coordinates | Lat. (o) | 29.45083 | Long. (o) | -89.75005 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060098 | Metagenome / Metatranscriptome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139329_1411331 | F060098 | N/A | MERTALKRAASAAVIGVGGLLWLAAILFMVQTAQNSEQF |
| ⦗Top⦘ |