| Basic Information | |
|---|---|
| Family ID | F060098 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLH |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.74 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 93.98 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (22.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.075 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (33.083 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF14334 | DUF4390 | 79.70 |
| PF01189 | Methyltr_RsmB-F | 17.29 |
| PF02911 | Formyl_trans_C | 2.26 |
| PF01327 | Pep_deformylase | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 17.29 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 2.26 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_100713041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 607 | Open in IMG/M |
| 3300003860|Ga0031658_1032909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 879 | Open in IMG/M |
| 3300004015|Ga0055462_10055424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1077 | Open in IMG/M |
| 3300004015|Ga0055462_10280004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 546 | Open in IMG/M |
| 3300004049|Ga0055493_10122508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 575 | Open in IMG/M |
| 3300004066|Ga0055484_10073655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 799 | Open in IMG/M |
| 3300004146|Ga0055495_10027853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1056 | Open in IMG/M |
| 3300004155|Ga0066600_10227387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 818 | Open in IMG/M |
| 3300004156|Ga0062589_100762122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 870 | Open in IMG/M |
| 3300004156|Ga0062589_102082871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 578 | Open in IMG/M |
| 3300004179|Ga0066404_1063407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 616 | Open in IMG/M |
| 3300004779|Ga0062380_10483492 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300004808|Ga0062381_10368992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 544 | Open in IMG/M |
| 3300005333|Ga0070677_10103782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1258 | Open in IMG/M |
| 3300005578|Ga0068854_101031402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 730 | Open in IMG/M |
| 3300005618|Ga0068864_102352167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 539 | Open in IMG/M |
| 3300005660|Ga0073904_10790263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 506 | Open in IMG/M |
| 3300005829|Ga0074479_10842981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 563 | Open in IMG/M |
| 3300005833|Ga0074472_10484602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1464 | Open in IMG/M |
| 3300006224|Ga0079037_100107608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 2358 | Open in IMG/M |
| 3300006224|Ga0079037_101130782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 777 | Open in IMG/M |
| 3300006224|Ga0079037_101225295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 746 | Open in IMG/M |
| 3300006844|Ga0075428_100073695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3729 | Open in IMG/M |
| 3300006930|Ga0079303_10421403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 568 | Open in IMG/M |
| 3300007004|Ga0079218_11590677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 715 | Open in IMG/M |
| 3300009009|Ga0105105_10312681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 852 | Open in IMG/M |
| 3300009053|Ga0105095_10468569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 697 | Open in IMG/M |
| 3300009075|Ga0105090_10389881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 850 | Open in IMG/M |
| 3300009075|Ga0105090_10398182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 840 | Open in IMG/M |
| 3300009075|Ga0105090_10398204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 840 | Open in IMG/M |
| 3300009075|Ga0105090_10485903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 751 | Open in IMG/M |
| 3300009081|Ga0105098_10638522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 559 | Open in IMG/M |
| 3300009085|Ga0105103_10114270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1410 | Open in IMG/M |
| 3300009085|Ga0105103_10846383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 533 | Open in IMG/M |
| 3300009087|Ga0105107_10430218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 920 | Open in IMG/M |
| 3300009091|Ga0102851_11188224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 839 | Open in IMG/M |
| 3300009091|Ga0102851_12215363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 626 | Open in IMG/M |
| 3300009091|Ga0102851_12935320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 548 | Open in IMG/M |
| 3300009111|Ga0115026_10416905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 977 | Open in IMG/M |
| 3300009131|Ga0115027_10165044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1372 | Open in IMG/M |
| 3300009131|Ga0115027_10404640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 955 | Open in IMG/M |
| 3300009165|Ga0105102_10199707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 999 | Open in IMG/M |
| 3300009165|Ga0105102_10248932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 904 | Open in IMG/M |
| 3300009168|Ga0105104_10390263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 773 | Open in IMG/M |
| 3300009169|Ga0105097_10172679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1190 | Open in IMG/M |
| 3300009169|Ga0105097_10292806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 899 | Open in IMG/M |
| 3300009169|Ga0105097_10392258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 771 | Open in IMG/M |
| 3300009169|Ga0105097_10857535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 520 | Open in IMG/M |
| 3300009170|Ga0105096_10076059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1666 | Open in IMG/M |
| 3300009170|Ga0105096_10124055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1293 | Open in IMG/M |
| 3300009170|Ga0105096_10324823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 787 | Open in IMG/M |
| 3300009179|Ga0115028_10054133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans | 2045 | Open in IMG/M |
| 3300009430|Ga0114938_1051286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1550 | Open in IMG/M |
| 3300009509|Ga0123573_10501163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1155 | Open in IMG/M |
| 3300010412|Ga0136852_11645833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 607 | Open in IMG/M |
| 3300010993|Ga0139329_141133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 503 | Open in IMG/M |
| 3300013297|Ga0157378_11448311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 730 | Open in IMG/M |
| 3300014296|Ga0075344_1086085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 622 | Open in IMG/M |
| 3300014316|Ga0075339_1021186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1539 | Open in IMG/M |
| 3300017965|Ga0190266_10093350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1214 | Open in IMG/M |
| 3300017965|Ga0190266_10700021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 632 | Open in IMG/M |
| 3300018079|Ga0184627_10541156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 595 | Open in IMG/M |
| 3300022309|Ga0224510_10100074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1659 | Open in IMG/M |
| 3300022396|Ga0210364_1011397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1313 | Open in IMG/M |
| 3300024056|Ga0124853_1212892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2668 | Open in IMG/M |
| 3300024985|Ga0208392_1072460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 542 | Open in IMG/M |
| 3300025130|Ga0209594_1154343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 680 | Open in IMG/M |
| 3300025930|Ga0207701_10851875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 765 | Open in IMG/M |
| 3300025961|Ga0207712_10809630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 824 | Open in IMG/M |
| 3300025964|Ga0210127_1033088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 616 | Open in IMG/M |
| 3300025967|Ga0210136_1088578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 503 | Open in IMG/M |
| 3300025984|Ga0210082_1063861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 617 | Open in IMG/M |
| 3300026068|Ga0208657_1016270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 705 | Open in IMG/M |
| 3300026476|Ga0256808_1018770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 899 | Open in IMG/M |
| 3300027683|Ga0209392_1098996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 929 | Open in IMG/M |
| 3300027721|Ga0209492_1246848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 605 | Open in IMG/M |
| 3300027762|Ga0209288_10178760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 689 | Open in IMG/M |
| 3300027778|Ga0209464_10147232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 825 | Open in IMG/M |
| 3300027778|Ga0209464_10272638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 613 | Open in IMG/M |
| 3300027885|Ga0209450_10214602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1365 | Open in IMG/M |
| 3300027885|Ga0209450_10404159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 996 | Open in IMG/M |
| 3300027885|Ga0209450_11195647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 528 | Open in IMG/M |
| 3300027885|Ga0209450_11263268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 509 | Open in IMG/M |
| 3300027887|Ga0208980_10385920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 809 | Open in IMG/M |
| 3300027899|Ga0209668_10904446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 595 | Open in IMG/M |
| 3300027956|Ga0209820_1058739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1023 | Open in IMG/M |
| 3300027956|Ga0209820_1199007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 559 | Open in IMG/M |
| 3300027975|Ga0209391_10228134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 762 | Open in IMG/M |
| 3300028597|Ga0247820_10718230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 698 | Open in IMG/M |
| 3300031577|Ga0316602_10079409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 560 | Open in IMG/M |
| 3300031901|Ga0307406_10919627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 746 | Open in IMG/M |
| 3300031908|Ga0310900_10688257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 817 | Open in IMG/M |
| 3300032012|Ga0310902_11229913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 528 | Open in IMG/M |
| 3300032164|Ga0315283_10070480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3582 | Open in IMG/M |
| 3300032164|Ga0315283_11498423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 691 | Open in IMG/M |
| 3300032275|Ga0315270_11043797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 542 | Open in IMG/M |
| 3300032397|Ga0315287_10276254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1976 | Open in IMG/M |
| 3300032397|Ga0315287_12608904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 540 | Open in IMG/M |
| 3300032397|Ga0315287_12731313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 524 | Open in IMG/M |
| 3300033413|Ga0316603_10588228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1031 | Open in IMG/M |
| 3300033414|Ga0316619_10151000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1597 | Open in IMG/M |
| 3300033414|Ga0316619_11085488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 701 | Open in IMG/M |
| 3300033416|Ga0316622_100044866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4105 | Open in IMG/M |
| 3300033416|Ga0316622_101507116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 785 | Open in IMG/M |
| 3300033418|Ga0316625_100747830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 829 | Open in IMG/M |
| 3300033418|Ga0316625_100749783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 828 | Open in IMG/M |
| 3300033418|Ga0316625_102366055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 533 | Open in IMG/M |
| 3300033419|Ga0316601_100083959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2513 | Open in IMG/M |
| 3300033419|Ga0316601_100301000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1467 | Open in IMG/M |
| 3300033419|Ga0316601_102011042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 582 | Open in IMG/M |
| 3300033434|Ga0316613_10515889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 812 | Open in IMG/M |
| 3300033434|Ga0316613_10560644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 778 | Open in IMG/M |
| 3300033434|Ga0316613_10804449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 645 | Open in IMG/M |
| 3300033480|Ga0316620_11849017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 600 | Open in IMG/M |
| 3300033481|Ga0316600_10072544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2013 | Open in IMG/M |
| 3300033481|Ga0316600_10340922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1017 | Open in IMG/M |
| 3300033483|Ga0316629_10200437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1266 | Open in IMG/M |
| 3300033485|Ga0316626_10800907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 826 | Open in IMG/M |
| 3300033487|Ga0316630_10263474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1307 | Open in IMG/M |
| 3300033487|Ga0316630_10529476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 970 | Open in IMG/M |
| 3300033487|Ga0316630_11264185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 657 | Open in IMG/M |
| 3300033487|Ga0316630_11838172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 554 | Open in IMG/M |
| 3300033488|Ga0316621_10442088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 896 | Open in IMG/M |
| 3300033488|Ga0316621_11311291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 550 | Open in IMG/M |
| 3300033521|Ga0316616_101452093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 886 | Open in IMG/M |
| 3300033521|Ga0316616_102299781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 719 | Open in IMG/M |
| 3300033557|Ga0316617_101196936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 754 | Open in IMG/M |
| 3300033557|Ga0316617_101784356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 628 | Open in IMG/M |
| 3300034052|Ga0373889_071423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 560 | Open in IMG/M |
| 3300034053|Ga0373890_031138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 796 | Open in IMG/M |
| 3300034055|Ga0373892_026009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 735 | Open in IMG/M |
| 3300034056|Ga0373893_061096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 529 | Open in IMG/M |
| 3300034080|Ga0373897_079118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 639 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 22.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 19.55% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 5.26% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 4.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.51% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 3.76% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.01% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.01% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.26% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.50% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.50% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.50% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.50% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.75% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.75% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004015 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004179 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 4_LOW4 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010993 | ECM15MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022396 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024985 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 3_LOW4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025967 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025984 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026068 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026476 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6 | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300031577 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034052 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2 | Engineered | Open in IMG/M |
| 3300034053 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.3 | Engineered | Open in IMG/M |
| 3300034055 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.2 | Engineered | Open in IMG/M |
| 3300034056 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3 | Engineered | Open in IMG/M |
| 3300034080 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1007130411 | 3300001213 | Wetland | MAASPLKRAFSVGIVGLGGLLWLAAILFMVQTAQNSEQF |
| Ga0031658_10329093 | 3300003860 | Freshwater Lake Sediment | MALPTLNRAVSAVVMGVGGLLWLAAILFMAQTAQNSEQFSRLHPWILMINVAG |
| Ga0055462_100554243 | 3300004015 | Natural And Restored Wetlands | MAASPLKRAFSVGLIGLGGLLWLAAILFMVQTAQNSEQFSRLHPWILGINVA |
| Ga0055462_102800042 | 3300004015 | Natural And Restored Wetlands | MAASPLKRAFSVGLIGLGGVLWLAAILFMAQTAQNSAQFSRLHPWILGI |
| Ga0055493_101225082 | 3300004049 | Natural And Restored Wetlands | MDAPSLRRTATAVVIGSGGLLWLAAILFMAQTAQHSAQFSRL |
| Ga0055484_100736552 | 3300004066 | Natural And Restored Wetlands | MDAPSLTRAASAVVMGIGGLLWLSALLFMAQTAQNSEQFSRLHPWILLIN |
| Ga0055495_100278531 | 3300004146 | Natural And Restored Wetlands | MDAPSLTRAASAVVMGIGGLLWLSALLFMAQTAQNSEQFSRLHPWILL |
| Ga0066600_102273872 | 3300004155 | Freshwater | MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILAINIA |
| Ga0062589_1007621223 | 3300004156 | Soil | MDTATLRRAGSAALMGIGGLLWLSAILFMAQTAQNSEQFGRLHPWILMVN |
| Ga0062589_1020828711 | 3300004156 | Soil | MDAASLRRAASAVLMGIGGLLWLAAILFMAQTAQNSEQFGRLHPWILMVN |
| Ga0066404_10634072 | 3300004179 | Freshwater | MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINIAG |
| Ga0062380_104834922 | 3300004779 | Wetland Sediment | MATSSLSRAFSVALMGVGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINVAGIAVLVV |
| Ga0062381_103689921 | 3300004808 | Wetland Sediment | MATASLSRVFSVVLMGVGGLLWLAAILFMAQTAQNSEQFS |
| Ga0070677_101037823 | 3300005333 | Miscanthus Rhizosphere | MDTATLRRAGSAALMGIGGLLWLSAILFMAQTAQNSEQFG |
| Ga0068854_1010314021 | 3300005578 | Corn Rhizosphere | MDAASVRRAASAVLMGIGGLLWLAAILFMAQTAQNSEQF |
| Ga0068864_1023521671 | 3300005618 | Switchgrass Rhizosphere | MDAPTLKRAASAITVGIGGLLWLAAILFMAQTAQNS |
| Ga0073904_107902632 | 3300005660 | Activated Sludge | MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILAI |
| Ga0074479_108429812 | 3300005829 | Sediment (Intertidal) | MAAPSLNRALSAGLMGLGGLLWLAAILFMAQTAQNSSQFSRLHPWILGIN |
| Ga0074472_104846021 | 3300005833 | Sediment (Intertidal) | MDAPTLKRAANAAVMGIGGLLWLAAILFMAQTAQNS |
| Ga0079037_1001076084 | 3300006224 | Freshwater Wetlands | MDAPTLRRAVAAVAIGGGGLLWLSAILFMARTAQHSEPFSRLHPWILAINIAGL |
| Ga0079037_1011307821 | 3300006224 | Freshwater Wetlands | MDTPTLRRAASMVVIGLGGLLWLAAILFMAQTAQHSEQFSRLH |
| Ga0079037_1012252951 | 3300006224 | Freshwater Wetlands | MDTPSLSRAASMIVVGLGGLLWLAAILFMAQTAQH |
| Ga0075428_1000736951 | 3300006844 | Populus Rhizosphere | MDAASLRRAGSAALMGIGGLLWLAAILFMAQTAQNSEQFG |
| Ga0079303_104214032 | 3300006930 | Deep Subsurface | MAASPLKRAFSVGIVGLGGLLWLAAILFMVQTAQNSEQFSRLHPW |
| Ga0079218_115906771 | 3300007004 | Agricultural Soil | MKRYAVSFVMAIGGLLWLAAILFMAQTAQNSEQFGR |
| Ga0105105_103126811 | 3300009009 | Freshwater Sediment | VDAPALKRAASAVIMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINIAGLV |
| Ga0105095_104685692 | 3300009053 | Freshwater Sediment | MDAPSLKRAASAVVIGFGGLLWLAAILFMAQTAQNSEQFSRLHPWILMINV |
| Ga0105090_103898811 | 3300009075 | Freshwater Sediment | MDAATLKRAASAIVIGVGGLLWLSAILFMAQTAQHSEQFSRWHPWILMINV |
| Ga0105090_103981821 | 3300009075 | Freshwater Sediment | MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINIAGL |
| Ga0105090_103982041 | 3300009075 | Freshwater Sediment | MDAPTLKRAASAVIMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINIAGL |
| Ga0105090_104859032 | 3300009075 | Freshwater Sediment | MDAAALKRAASAVVIGAGGLLWLAAILFMAQTAQNSDQF |
| Ga0105098_106385222 | 3300009081 | Freshwater Sediment | MDAPSLSRAASMIVIGLGGLLWLAAILFMAQTAQHSEQFSRL |
| Ga0105103_101142701 | 3300009085 | Freshwater Sediment | MDAPSLKRAASAVVIGFGGLLWLAAILFMAQTAQNSEQF |
| Ga0105103_108463831 | 3300009085 | Freshwater Sediment | MDAPSLKRAASAVVIGSGGLLWLAAILFMAQTAQNSEQFSRLHPWILMINVAGL |
| Ga0105107_104302181 | 3300009087 | Freshwater Sediment | MDAPSLKRAASAVVIGFGGLRWLAAILFMAQTAQNSEQFSRLHPW |
| Ga0102851_111882243 | 3300009091 | Freshwater Wetlands | MDTPTLSRAASMVVIGLGGLLWLAAILFMAQTAQHSEQFS |
| Ga0102851_122153632 | 3300009091 | Freshwater Wetlands | MDAAALRRAASAAVIGIGGLLWLSAILFMAQTAQHSEQFSRLHPWILMINIA |
| Ga0102851_129353201 | 3300009091 | Freshwater Wetlands | MDTPSLSRAASMVVIGLGGLLWLAAILFMAQTAQHSEQFSRLHPW |
| Ga0115026_104169053 | 3300009111 | Wetland | MDAPAIKRAASAVVIGFGGLLWLAAILFMAQTAQNSEQF |
| Ga0115027_101650441 | 3300009131 | Wetland | MDAATLKRAASAIVIGVGGLLWLSAILFMAQTAQHSEQFSRWHPWILMINVAGLVVLV |
| Ga0115027_104046403 | 3300009131 | Wetland | MDAPTLKRAASAATMGLGGLLWLAAILFMAQTAQNSEQF |
| Ga0105102_101997071 | 3300009165 | Freshwater Sediment | MDAPALRRVAVAAAMGVGGLLWLSAILLMARTAQHAEPFSQLHPW |
| Ga0105102_102489321 | 3300009165 | Freshwater Sediment | MDAATLKRAASAVVIGVGGLLWLSAILFMAQTAQHSEQFSR |
| Ga0105104_103902632 | 3300009168 | Freshwater Sediment | MDAPALRRAAVAAAMGVGGLLWLSAILLMARTAQHAEPFSQLHPWI |
| Ga0105097_101726791 | 3300009169 | Freshwater Sediment | MDAPALRRAAAAAAMGVGGLLWLSAILFMARTAQHSEPFSRLHPWILMINVA |
| Ga0105097_102928063 | 3300009169 | Freshwater Sediment | MDAPTLKRAASAVVVGVGGLLWLAAILFMAQTAQNSE |
| Ga0105097_103922581 | 3300009169 | Freshwater Sediment | MDAPSLKRAASAVVIGFGGLLWLAAILFMAQTAQNSEQFSR |
| Ga0105097_108575351 | 3300009169 | Freshwater Sediment | MDAATLKRAASAVVVGVGGLLWLAAILFMAQTAQNSEQFSR |
| Ga0105096_100760591 | 3300009170 | Freshwater Sediment | MDAATLKRAASAVVIGVGGLLWLSAILFMAQTAQHSEQFSRWHPWILMI |
| Ga0105096_101240551 | 3300009170 | Freshwater Sediment | MDAPALRRAAAAAAMGVGGLLWLSAILFMARTAQHSEPFSRLHPW |
| Ga0105096_103248232 | 3300009170 | Freshwater Sediment | MDAPTLKRAASAVIMGLGGLLWLAAILFMAQTAQKSEQISRLHPWNPR |
| Ga0115028_100541331 | 3300009179 | Wetland | MDAATLKRAASAIVIGVGGLLWLSAILFMAQTAQHSEQFSRWHPWILMI |
| Ga0114938_10512863 | 3300009430 | Groundwater | MDASSLRKAAAAAAMSVGGLLWLSAILFMARTAQHSEPFSRLH |
| Ga0123573_105011631 | 3300009509 | Mangrove Sediment | MDTPTLNRAVSAVVIGVGGLLWLSAILFMAYTAQHS |
| Ga0136852_116458332 | 3300010412 | Mangrove Sediment | MDTPSLSRTVSAAVIVLGGLLWFAAILFMAQTAQHSE |
| Ga0139329_1411331 | 3300010993 | Sediment | MERTALKRAASAAVIGVGGLLWLAAILFMVQTAQNSEQF |
| Ga0157378_114483111 | 3300013297 | Miscanthus Rhizosphere | MDAPTLKRAASAITVGIGGLLWLAAILFMAQTAQNSSQ |
| Ga0075344_10860851 | 3300014296 | Natural And Restored Wetlands | MAGSPLKRALSAGLIGLGGLLWLAAILFMVQTAQNSEQFSRLHPWIL |
| Ga0075339_10211863 | 3300014316 | Natural And Restored Wetlands | MAASPLKRAFSVGLIGLGGVLWLAAILFMAQTAQNSAQFSRLH |
| Ga0190266_100933501 | 3300017965 | Soil | MDTATLRRAGSAALMGIGGLLWLSAILFMAQTAQNSEQFGRLHPWILM |
| Ga0190266_107000211 | 3300017965 | Soil | MDAPSLKRAASAVTIGIGGLLWLAAILSMAQTAQNSEQFSRLH |
| Ga0184627_105411561 | 3300018079 | Groundwater Sediment | MDAAALKRGASSVLMGVGGLLWLAAILFMAQTAQNSEQV |
| Ga0224510_101000743 | 3300022309 | Sediment | MDAPSLSRAASAVVMGIGGLLWLSALLFMAQTAQNSEQ |
| Ga0210364_10113971 | 3300022396 | Estuarine | MDAPSLTRAASAVVMGIGGLLWLSALLFMAQTAQNSE |
| Ga0124853_12128922 | 3300024056 | Freshwater Wetlands | MDAPSLNRTASLVVIGGGGLLWLSAILFMAQTAQHSAQFSRLHPWILMSTWRAWWCCSAC |
| Ga0208392_10724602 | 3300024985 | Freshwater Sediment | MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLH |
| Ga0209594_11543432 | 3300025130 | Groundwater | MDTPTLSRAASMVVIGLGGLLWLAAILFMAQTAQHSEQFSRLHPWI |
| Ga0207701_108518752 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAPTLKRAVSAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILAI |
| Ga0207712_108096301 | 3300025961 | Switchgrass Rhizosphere | MDAASLRRAASAVLMGIGGLLWLAAILFMAQTAQNSEQFGRLHPW |
| Ga0210127_10330882 | 3300025964 | Natural And Restored Wetlands | MDAPSLTRAASAVVMGIGGLLWLSALLFMAQTAQNSEQFSRLHPWILLINVVGL |
| Ga0210136_10885781 | 3300025967 | Natural And Restored Wetlands | MAAPTLKRALAAGLMGLGGLLWLAAILFMAQTAQNSTQFSRLHPWIL |
| Ga0210082_10638611 | 3300025984 | Natural And Restored Wetlands | MDAPSLSRAASAVVMGIGGLLWLSALLFMAQTAQNSEQFSR |
| Ga0208657_10162702 | 3300026068 | Natural And Restored Wetlands | MDASSLRGATAAAAMSVGGLLWLSAILFMARTAQHSEPFSRLHPW |
| Ga0256808_10187701 | 3300026476 | Sediment | MDTPTLSRTASMVVIGLGGLLWLAAILFMAQTAQHSEQFSRLHPWILMI |
| Ga0209392_10989961 | 3300027683 | Freshwater Sediment | MDAPALRRAAAAAAMGVGGLLWLSAILFMARTAQHSA |
| Ga0209492_12468481 | 3300027721 | Freshwater Sediment | MDTPTLSRAASMIVIGLGGLLWLAAILFMAQTAQHSEQFSRLHPWI |
| Ga0209288_101787601 | 3300027762 | Freshwater Sediment | VEDVDAPALKRAASAVIMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINI |
| Ga0209464_101472323 | 3300027778 | Wetland Sediment | MATASLSRVFSVVLMGVGGLLWLAAILFMAQTAQNSEQFSRLHPW |
| Ga0209464_102726381 | 3300027778 | Wetland Sediment | MAAPTLKRALAAGLMGLGGLLWLAAILFMAQTAQNS |
| Ga0209450_102146023 | 3300027885 | Freshwater Lake Sediment | MAASSVSRALFIALAGVGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINVAGI |
| Ga0209450_104041591 | 3300027885 | Freshwater Lake Sediment | MDAPTLKRAANAAVMGVGGLLWLAAILFMAQTAQNSEQF |
| Ga0209450_111956472 | 3300027885 | Freshwater Lake Sediment | MDAASLKRAASAIVIGVGGLLWLSAILFMAQTAQHSEQFSRWHPW |
| Ga0209450_112632681 | 3300027885 | Freshwater Lake Sediment | MDAPTLRRAAAAAAIGGGGLLWLSAILFMARTAQHSEPFS |
| Ga0208980_103859202 | 3300027887 | Wetland | MAAVTLKRAFSTGLMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGI |
| Ga0209668_109044462 | 3300027899 | Freshwater Lake Sediment | MDAPALKRAASAVTVGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINIA |
| Ga0209820_10587393 | 3300027956 | Freshwater Sediment | VENVDTPALKRAATAVTMGLGGLLWLAAILFMAQTAQNSE |
| Ga0209820_11990071 | 3300027956 | Freshwater Sediment | MDAPTLSRAASMVVIGLGGLLWLTAILFMAQTAQHSEQFSRLHPWILMINVAGLV |
| Ga0209391_102281341 | 3300027975 | Freshwater Sediment | MDAAALKRAASAVVIGAGGLLWLAAILFMAQTAQNSDQFSRLH |
| Ga0247820_107182301 | 3300028597 | Soil | MDAPTLKRAASAVVMGVGGLLWLAAILFMAQTAQNSEQFSRLHPWILMI |
| Ga0316602_100794091 | 3300031577 | Soil | MDVASLRRAVSVIAIGGGGLLWLSAILFMAQTAQHSEQFSRLHPWILMI |
| Ga0307406_109196271 | 3300031901 | Rhizosphere | MDAPALKRAASTVIVGIGGLLWLAAILFMAQTAQNSEQFSRLHPW |
| Ga0310900_106882571 | 3300031908 | Soil | MRRYASTVLIGIGGLLWLAAILFMAQTAQNSDQFGRL |
| Ga0310902_112299132 | 3300032012 | Soil | MDAPSLKRAASAATMGIGGLLWLAAILSMAQTAQNSEQ |
| Ga0315283_100704801 | 3300032164 | Sediment | MAAPSVTRFLSVALVAVGGLLWLAAILFMVQTAQNSEQFSRLHPWILGINIAGIAVL |
| Ga0315283_114984232 | 3300032164 | Sediment | MAAPFLSRAFSAALMGIGGLLWLSAILFMAQTAQNSEQFSRLHPGS |
| Ga0315270_110437971 | 3300032275 | Sediment | MATSSLSRAFSVALMGVGGLLWLAAILFMAQTAQNS |
| Ga0315287_102762541 | 3300032397 | Sediment | VDAPTLKRAANAAVMGVGGLLWLAVILFMAQTAQNS |
| Ga0315287_126089042 | 3300032397 | Sediment | MAAASLSRVLSVVLMGVGGLLWLVAILFMAQTAQNSE |
| Ga0315287_127313131 | 3300032397 | Sediment | MENMDARTLKRAAAAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINI |
| Ga0316603_105882281 | 3300033413 | Soil | VVRVDAPTLRRAAAAAAIGGGGLLWLSAILFMARTAQHSEPFSRLHPWI |
| Ga0316619_101510001 | 3300033414 | Soil | MAASSVSRAFSIALMGVGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINMAGI |
| Ga0316619_110854881 | 3300033414 | Soil | MDTSSLRRAAAAAAMSIGGLLWLSAILLMARTAQHSEPFSELHPWILLIN |
| Ga0316622_1000448661 | 3300033416 | Soil | MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNS |
| Ga0316622_1015071161 | 3300033416 | Soil | MDTPSLKSAAWMTVVGLGGLLWLAAILFMAQTAQHSEQFSRLHPWILM |
| Ga0316625_1007478303 | 3300033418 | Soil | MAAPTLKRAFSIAFIGLGGLLWLAAILFMVQTAQNSAQFG |
| Ga0316625_1007497832 | 3300033418 | Soil | MALPTLNRAVSVVVMGVGGLLWLAAILFMAQTAQNSEQFSRLHPWILMINVAGL |
| Ga0316625_1023660551 | 3300033418 | Soil | MATSPVSRAFSIVLMGVGGLLWLAAILFMAQTAQNSEQFSRLHPWIL |
| Ga0316601_1000839591 | 3300033419 | Soil | MDAPTLKRAASAVVVGVGGLLWLAAILFMAQTAQN |
| Ga0316601_1003010003 | 3300033419 | Soil | MDAPTLRRAVAAVAIGGGGLLWLSAILFMARTAQHSEPFSRLHPWILAINIAGLAVLLGLLATK |
| Ga0316601_1020110422 | 3300033419 | Soil | MDTSSLRRAAAAAAMSVGGLLWLSAILLMARTAQHSEPFSQLHPWILLINV |
| Ga0316613_105158893 | 3300033434 | Soil | MDAPSLKRTLSAVVIVLGGVLWLAAILFMAQTAQHSEQFSRLH |
| Ga0316613_105606442 | 3300033434 | Soil | MDAPTLRRAAAAAAIGGGGLLWLSAILFMARTAQHSEPFSRLHP |
| Ga0316613_108044492 | 3300033434 | Soil | MDAPSLKRAASAAVMGIGGLLWLSAILFMAQTAQNSEQFSRLHPWILMIN |
| Ga0316620_118490171 | 3300033480 | Soil | MDTPSLSRAASMIVVGLGGLLWLAAILFMAQTAQHSEQFSRLHPW |
| Ga0316600_100725443 | 3300033481 | Soil | MDAPSLRKAAAAAAMGVGGLLWLSAILFMARTAQHSEPFSRLHPW |
| Ga0316600_103409221 | 3300033481 | Soil | MALPTLNRAVSVVVMGVGGLLWLAAILFMAQTAQNSEQFSRLHPWIL |
| Ga0316629_102004373 | 3300033483 | Soil | MATSPVSRAFSIVLMGVGGLLWLAAILFMAQTAQNSEQF |
| Ga0316626_108009071 | 3300033485 | Soil | MDTSSLRRAAAAAAMSVGGLLWLSAILLMARTAQHSEPFSQLHPWIL |
| Ga0316630_102634741 | 3300033487 | Soil | MDTPSLSRAASMVVIGLGGLLWLAAILFMAQTAQHSAQFSRLHP |
| Ga0316630_105294763 | 3300033487 | Soil | MDTSSLRRAAAAAAMSVGGLLWLSAILLMARTAQHSEPFSQLHPWILLIN |
| Ga0316630_112641852 | 3300033487 | Soil | MAASALSRAFSTALVGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINVAGLVMLVGL |
| Ga0316630_118381721 | 3300033487 | Soil | MDAPTLKRAASAAVMGIGGLLWLAAILFMAQTAQNSEQFSR |
| Ga0316621_104420883 | 3300033488 | Soil | MDAAALRRAASAAVIGIGGLLWLSAILFMAQTAQHSEQFSRLHPWILMIN |
| Ga0316621_113112911 | 3300033488 | Soil | MDAASLRRAASVVAIGGGGLLWLSAILFMAQTAQHSEQFSRLHPWILMINVAGL |
| Ga0316616_1014520931 | 3300033521 | Soil | MDAPSLRRTASLVVIGCGGLLWLSAILFMAQTAQHSAQ |
| Ga0316616_1022997812 | 3300033521 | Soil | MDTSSLRRAAAAAAMSIGGLLWLSAILLMARTAQHSEPFSELHPW |
| Ga0316617_1011969362 | 3300033557 | Soil | MDAPTLRRAATAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLH |
| Ga0316617_1017843561 | 3300033557 | Soil | MDTPSLSRTASMVVIGLGGLLWLAAILFMAQTAQHSEQFSRLHPWILMIN |
| Ga0373889_071423_407_559 | 3300034052 | Sediment Slurry | MDTPSLSRTVSAAVIVIGGLLWFAAILFMAQTAQNSEQFSRLHPWILAINV |
| Ga0373890_031138_650_796 | 3300034053 | Sediment Slurry | MDAPALRRVVSLVVIGLGGLLWLAAILFMAQTAQHSEQFSRLHPWILMI |
| Ga0373892_026009_616_735 | 3300034055 | Sediment Slurry | MDAATLKRAVSAIVIGVGGLLWLSAILFMAQTAQHSEQFS |
| Ga0373893_061096_3_134 | 3300034056 | Sediment Slurry | MDTPALKRAASAVVIGAGGLLWLAAILFMAQTAQNSEQFSRLHP |
| Ga0373897_079118_462_638 | 3300034080 | Sediment Slurry | MDTPSLSRTVSAAVIVLGGLLWFAAIMFMAQTAQHSEQFSRLHPWILMINVAGLVVLVG |
| ⦗Top⦘ |