Scaffold Ga0139307_115587

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0139307_115587

Scaffold Ga0139307_115587

Overview

Basic Information
Taxon OID	3300010991 Open in IMG/M
Scaffold ID	Ga0139307_115587 Open in IMG/M
Source Dataset Name	ELM10016_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	644
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes

Source Dataset Sampling Location
Location Name	Louisiana, Port Sulphur, Bay Sansbois east
Coordinates	Lat. (^o)	29.45497	Long. (^o)	-89.758933	Alt. (m)		Depth (m)	0 to .02
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015864	Metagenome / Metatranscriptome	251	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139307_1155871	F015864	N/A	MTDFHYSTGEELEQFLYEKCREDPDLLATIISEYVCSLSDNKLIELEDFLTNNFGDD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.