Scaffold Ga0138108_100254

Overview

Basic Information

• Taxon OID: 3300010963
• Scaffold ID: Ga0138108_100254
• Source Dataset Name: Subsoil microbial communities from Rio Tinto Huelva, Spain - T211
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Autonomous University of Barcelona
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12388
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Subsoil → Subsoil Microbial Communities From Rio Tinto Huelva, Spain

Source Dataset Sampling Location

• Location Name: Huelva, Spain
• Coordinates
  • Lat. (^o): 37.26
  • Long. (^o): -6.94
  • Depth (m): 250

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021823	Metagenome / Metatranscriptome	217	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138108_1002545	F021823	GAGG	MNAFVRRFVMHYGIYRRYPLARIDALRNAWRIARA*