Metagenome / Metatranscriptome Family F021823

Basic Information
Family ID	F021823
Family Type	Metagenome / Metatranscriptome
Number of Sequences	217
Average Sequence Length	37 residues
Representative Sequence	MRAFTRRFLMHYGIYRRYPLGRLPALRNAWRTARA
Number of Associated Samples	152
Number of Associated Scaffolds	217

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	65.44 %
% of genes near scaffold ends (potentially truncated)	26.73 %
% of genes from short scaffolds (< 2000 bps)	85.71 %
Associated GOLD sequencing projects	143
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Bacteria (79.263 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.982 % of family members)
Environment Ontology (ENVO)	Unclassified (29.493 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (60.369 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 217 Family Scaffolds
PF03989	DNA_gyraseA_C	12.44
PF04377	ATE_C	6.45
PF03401	TctC	3.69
PF04392	ABC_sub_bind	2.30
PF03692	CxxCxxCC	1.84
PF10129	OpgC_C	1.38
PF04191	PEMT	1.38
PF12681	Glyoxalase_2	0.92
PF04355	SmpA_OmlA	0.92
PF00694	Aconitase_C	0.92
PF00330	Aconitase	0.92
PF05014	Nuc_deoxyrib_tr	0.92
PF06271	RDD	0.92
PF00903	Glyoxalase	0.92
PF00072	Response_reg	0.92
PF08031	BBE	0.46
PF02445	NadA	0.46
PF01272	GreA_GreB	0.46
PF02776	TPP_enzyme_N	0.46
PF00239	Resolvase	0.46
PF01381	HTH_3	0.46
PF00701	DHDPS	0.46
PF00210	Ferritin	0.46
PF01799	Fer2_2	0.46
PF13242	Hydrolase_like	0.46
PF13188	PAS_8	0.46
PF13557	Phenol_MetA_deg	0.46
PF02254	TrkA_N	0.46
PF13924	Lipocalin_5	0.46
PF01425	Amidase	0.46
PF00490	ALAD	0.46
PF01850	PIN	0.46
PF03069	FmdA_AmdA	0.46
PF01566	Nramp	0.46
PF08309	LVIVD	0.46
PF02371	Transposase_20	0.46
PF02615	Ldh_2	0.46
PF13180	PDZ_2	0.46
PF01656	CbiA	0.46
PF01522	Polysacc_deac_1	0.46
PF08545	ACP_syn_III	0.46
PF02754	CCG	0.46
PF13439	Glyco_transf_4	0.46
PF13489	Methyltransf_23	0.46
PF03797	Autotransporter	0.46
PF04199	Cyclase	0.46
PF13191	AAA_16	0.46

COG ID	Name	Functional Category	% Frequency in 217 Family Scaffolds
COG0188	DNA gyrase/topoisomerase IV, subunit A	Replication, recombination and repair [L]	12.44
COG2935	Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase	Posttranslational modification, protein turnover, chaperones [O]	6.45
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	3.69
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.30
COG3613	Nucleoside 2-deoxyribosyltransferase	Nucleotide transport and metabolism [F]	0.92
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	0.92
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	0.92
COG2913	Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex	Cell wall/membrane/envelope biogenesis [M]	0.92
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.46
COG5276	Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain	Function unknown [S]	0.46
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.46
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.46
COG2421	Acetamidase/formamidase	Energy production and conversion [C]	0.46
COG2055	Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family	Energy production and conversion [C]	0.46
COG2048	Heterodisulfide reductase, subunit B	Energy production and conversion [C]	0.46
COG0113	Delta-aminolevulinic acid dehydratase, porphobilinogen synthase	Coenzyme transport and metabolism [H]	0.46
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	0.46
COG1878	Kynurenine formamidase	Amino acid transport and metabolism [E]	0.46
COG0782	Transcription elongation factor, GreA/GreB family	Transcription [K]	0.46
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.46
COG0379	Quinolinate synthase	Coenzyme transport and metabolism [H]	0.46
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.46
COG0247	Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF	Energy production and conversion [C]	0.46
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.46

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	79.26 %
Unclassified	root	N/A	20.74 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	79.26 %
Unclassified	root	N/A	20.74 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	79.26 %
Unclassified	root	N/A	20.74 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	70.97 %
Unclassified	root	N/A	20.74 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.38 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.46 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	54.84 %
Unclassified	root	N/A	20.74 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.38 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.46 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.46 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.46 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	35.48 %
Unclassified	root	N/A	20.74 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1.38 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.38 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.38 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.46 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.74 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	19.82 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.07 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.38 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	1.38 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %
Thalassobaculaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae	0.92 %
Pleomorphomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae	0.92 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.46 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.46 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.46 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.46 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.74 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	19.82 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	1.38 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.38 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %
Oceanibaculum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum	0.92 %
Hartmannibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Hartmannibacter	0.92 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.92 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.46 %
Rhodopseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas	0.46 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.46 %
unclassified Rhodospirillaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae	0.46 %
Methylovirgula	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula	0.46 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.46 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.74 %
Rhodoplanes piscinae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	19.35 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	1.38 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.38 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %
Hartmannibacter diazotrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Hartmannibacter → Hartmannibacter diazotrophicus	0.92 %
Oceanibaculum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum	0.92 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.92 %
unclassified Afipia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia	0.46 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.46 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	0.46 %
Rhodopseudomonas faecalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis	0.46 %
Methylovirgula ligni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni	0.46 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.46 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.46 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.74 %
Rhodoplanes piscinae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	19.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.38 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.92 %
Hartmannibacter diazotrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Hartmannibacter → Hartmannibacter diazotrophicus	0.92 %
Oceanibaculum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum	0.92 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.92 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.46 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.46 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.46 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	0.46 %
Rhodopseudomonas faecalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis	0.46 %
Methylovirgula ligni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni	0.46 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.46 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.46 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.46 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000363\|ICChiseqgaiiFebDRAFT_13872126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	698	Open in IMG/M
3300001471\|JGI12712J15308_10040512	All Organisms → cellular organisms → Bacteria → Proteobacteria	1192	Open in IMG/M
3300002245\|JGIcombinedJ26739_101362115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	602	Open in IMG/M
3300004082\|Ga0062384_100447805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	843	Open in IMG/M
3300005332\|Ga0066388_100049876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni	4282	Open in IMG/M
3300005332\|Ga0066388_100961206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1424	Open in IMG/M
3300005332\|Ga0066388_104733570	Not Available	692	Open in IMG/M
3300005436\|Ga0070713_101663514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	620	Open in IMG/M
3300005531\|Ga0070738_10000840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	76109	Open in IMG/M
3300005542\|Ga0070732_10326982	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	922	Open in IMG/M
3300005559\|Ga0066700_10662823	All Organisms → cellular organisms → Bacteria → Proteobacteria	721	Open in IMG/M
3300005586\|Ga0066691_10528614	All Organisms → cellular organisms → Bacteria	704	Open in IMG/M
3300005614\|Ga0068856_100659272	All Organisms → cellular organisms → Bacteria	1067	Open in IMG/M
3300005617\|Ga0068859_100342938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1588	Open in IMG/M
3300005713\|Ga0066905_100096928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1991	Open in IMG/M
3300005713\|Ga0066905_101076355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	713	Open in IMG/M
3300005764\|Ga0066903_100105159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3837	Open in IMG/M
3300005764\|Ga0066903_100145994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3382	Open in IMG/M
3300005764\|Ga0066903_100206957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2947	Open in IMG/M
3300005764\|Ga0066903_100221512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2869	Open in IMG/M
3300005764\|Ga0066903_100231687	All Organisms → cellular organisms → Bacteria → Proteobacteria	2818	Open in IMG/M
3300005764\|Ga0066903_100233111	All Organisms → cellular organisms → Bacteria	2811	Open in IMG/M
3300005764\|Ga0066903_100518267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2028	Open in IMG/M
3300005764\|Ga0066903_101534857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1259	Open in IMG/M
3300005764\|Ga0066903_102056112	Not Available	1098	Open in IMG/M
3300005764\|Ga0066903_102706085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	962	Open in IMG/M
3300005764\|Ga0066903_103531902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	842	Open in IMG/M
3300005764\|Ga0066903_104274046	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	764	Open in IMG/M
3300005764\|Ga0066903_104766976	All Organisms → cellular organisms → Bacteria → Proteobacteria	721	Open in IMG/M
3300005764\|Ga0066903_105184550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	690	Open in IMG/M
3300005764\|Ga0066903_105510930	Not Available	667	Open in IMG/M
3300005764\|Ga0066903_107780570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	551	Open in IMG/M
3300005764\|Ga0066903_108073708	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	539	Open in IMG/M
3300005921\|Ga0070766_10794400	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300005937\|Ga0081455_10475892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	846	Open in IMG/M
3300005983\|Ga0081540_1000474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	39520	Open in IMG/M
3300005985\|Ga0081539_10059397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2105	Open in IMG/M
3300006028\|Ga0070717_10364007	All Organisms → cellular organisms → Bacteria → Proteobacteria	1295	Open in IMG/M
3300006174\|Ga0075014_100821975	Not Available	550	Open in IMG/M
3300006175\|Ga0070712_100068916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	2522	Open in IMG/M
3300006175\|Ga0070712_100129651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1909	Open in IMG/M
3300006175\|Ga0070712_102009138	Not Available	506	Open in IMG/M
3300006176\|Ga0070765_100089471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2634	Open in IMG/M
3300006178\|Ga0075367_10090533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	1861	Open in IMG/M
3300006186\|Ga0075369_10002471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6597	Open in IMG/M
3300006186\|Ga0075369_10505149	Not Available	575	Open in IMG/M
3300006195\|Ga0075366_10847816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	569	Open in IMG/M
3300006806\|Ga0079220_10287857	Not Available	1007	Open in IMG/M
3300006852\|Ga0075433_10985701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis	734	Open in IMG/M
3300006893\|Ga0073928_10161931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	1793	Open in IMG/M
3300009038\|Ga0099829_10372669	Not Available	1178	Open in IMG/M
3300009176\|Ga0105242_10482912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1175	Open in IMG/M
3300009525\|Ga0116220_10236407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	796	Open in IMG/M
3300009792\|Ga0126374_10660891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum	780	Open in IMG/M
3300009820\|Ga0105085_1020807	All Organisms → cellular organisms → Bacteria → Proteobacteria	1137	Open in IMG/M
3300009826\|Ga0123355_10235521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2605	Open in IMG/M
3300009826\|Ga0123355_11732312	Not Available	593	Open in IMG/M
3300009840\|Ga0126313_11613843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	540	Open in IMG/M
3300010046\|Ga0126384_11806504	Not Available	580	Open in IMG/M
3300010047\|Ga0126382_10592233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	911	Open in IMG/M
3300010048\|Ga0126373_10275479	Not Available	1667	Open in IMG/M
3300010048\|Ga0126373_11161831	Not Available	838	Open in IMG/M
3300010154\|Ga0127503_10848322	Not Available	607	Open in IMG/M
3300010343\|Ga0074044_10189571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1368	Open in IMG/M
3300010343\|Ga0074044_10772781	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	627	Open in IMG/M
3300010358\|Ga0126370_10285664	All Organisms → cellular organisms → Bacteria	1300	Open in IMG/M
3300010358\|Ga0126370_10938628	Not Available	784	Open in IMG/M
3300010358\|Ga0126370_11609082	Not Available	622	Open in IMG/M
3300010360\|Ga0126372_10487855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	1153	Open in IMG/M
3300010360\|Ga0126372_10728412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum	972	Open in IMG/M
3300010360\|Ga0126372_12138085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	608	Open in IMG/M
3300010360\|Ga0126372_12463256	All Organisms → cellular organisms → Bacteria → Proteobacteria	571	Open in IMG/M
3300010360\|Ga0126372_13242132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	506	Open in IMG/M
3300010361\|Ga0126378_10358614	All Organisms → cellular organisms → Bacteria → Proteobacteria	1568	Open in IMG/M
3300010376\|Ga0126381_102649607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	717	Open in IMG/M
3300010379\|Ga0136449_100458206	All Organisms → cellular organisms → Bacteria → Proteobacteria	2234	Open in IMG/M
3300010379\|Ga0136449_101222834	Not Available	1180	Open in IMG/M
3300010400\|Ga0134122_10663096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	974	Open in IMG/M
3300010963\|Ga0138108_100254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	12388	Open in IMG/M
3300011270\|Ga0137391_10022289	All Organisms → cellular organisms → Bacteria	5235	Open in IMG/M
3300012088\|Ga0153944_1033265	All Organisms → cellular organisms → Bacteria → Proteobacteria	1138	Open in IMG/M
3300012096\|Ga0137389_11132989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	670	Open in IMG/M
3300012189\|Ga0137388_11427308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	631	Open in IMG/M
3300012212\|Ga0150985_110375346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	628	Open in IMG/M
3300012212\|Ga0150985_118884085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1272	Open in IMG/M
3300012362\|Ga0137361_10843643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Hartmannibacter → Hartmannibacter diazotrophicus	832	Open in IMG/M
3300012469\|Ga0150984_101552587	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300012469\|Ga0150984_112940970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1035	Open in IMG/M
3300012925\|Ga0137419_11693884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	539	Open in IMG/M
3300012955\|Ga0164298_10912955	Not Available	640	Open in IMG/M
3300012957\|Ga0164303_10924840	Not Available	613	Open in IMG/M
3300012964\|Ga0153916_12809777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	549	Open in IMG/M
3300012971\|Ga0126369_11079489	Not Available	892	Open in IMG/M
3300014165\|Ga0181523_10327525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	861	Open in IMG/M
3300014168\|Ga0181534_10497992	All Organisms → cellular organisms → Bacteria → Proteobacteria	689	Open in IMG/M
3300014489\|Ga0182018_10447171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	687	Open in IMG/M
3300014493\|Ga0182016_10242897	All Organisms → cellular organisms → Bacteria → Proteobacteria	1132	Open in IMG/M
3300014501\|Ga0182024_11838677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	676	Open in IMG/M
3300015242\|Ga0137412_10198068	Not Available	1605	Open in IMG/M
3300016270\|Ga0182036_11094146	All Organisms → cellular organisms → Bacteria → Proteobacteria	660	Open in IMG/M
3300016294\|Ga0182041_10479969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1074	Open in IMG/M
3300016294\|Ga0182041_11634208	Not Available	595	Open in IMG/M
3300016319\|Ga0182033_10170702	Not Available	1701	Open in IMG/M
3300016319\|Ga0182033_10529651	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1016	Open in IMG/M
3300016422\|Ga0182039_11335504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	650	Open in IMG/M
3300016445\|Ga0182038_11350395	Not Available	638	Open in IMG/M
3300017932\|Ga0187814_10436832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	512	Open in IMG/M
3300017942\|Ga0187808_10245420	All Organisms → cellular organisms → Bacteria → Proteobacteria	801	Open in IMG/M
3300017943\|Ga0187819_10123387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1546	Open in IMG/M
3300017947\|Ga0187785_10296312	Not Available	742	Open in IMG/M
3300017955\|Ga0187817_11077359	All Organisms → cellular organisms → Bacteria → Proteobacteria	515	Open in IMG/M
3300017970\|Ga0187783_10345090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1084	Open in IMG/M
3300017970\|Ga0187783_10474455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	907	Open in IMG/M
3300017972\|Ga0187781_10071923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	2384	Open in IMG/M
3300017973\|Ga0187780_11298826	Not Available	535	Open in IMG/M
3300017974\|Ga0187777_11041063	Not Available	593	Open in IMG/M
3300017975\|Ga0187782_10447697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	984	Open in IMG/M
3300017975\|Ga0187782_10850100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	707	Open in IMG/M
3300018032\|Ga0187788_10267450	Not Available	683	Open in IMG/M
3300018034\|Ga0187863_10894105	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	504	Open in IMG/M
3300018062\|Ga0187784_10513507	Not Available	965	Open in IMG/M
3300018062\|Ga0187784_11220322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	596	Open in IMG/M
3300018433\|Ga0066667_11317890	Not Available	631	Open in IMG/M
3300018466\|Ga0190268_10214508	All Organisms → cellular organisms → Bacteria → Proteobacteria	1066	Open in IMG/M
3300018481\|Ga0190271_12871664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	578	Open in IMG/M
3300019238\|Ga0180112_1228210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	609	Open in IMG/M
3300019248\|Ga0180117_1222374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	667	Open in IMG/M
3300020593\|Ga0180221_1015972	All Organisms → cellular organisms → Bacteria → Proteobacteria	2505	Open in IMG/M
3300021086\|Ga0179596_10051620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1709	Open in IMG/M
3300021168\|Ga0210406_10608608	Not Available	852	Open in IMG/M
3300021170\|Ga0210400_10801101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	772	Open in IMG/M
3300021180\|Ga0210396_11021307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	699	Open in IMG/M
3300021401\|Ga0210393_11352212	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300021402\|Ga0210385_10325514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1144	Open in IMG/M
3300021403\|Ga0210397_10199387	Not Available	1430	Open in IMG/M
3300021441\|Ga0213871_10021362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1613	Open in IMG/M
3300021475\|Ga0210392_11405041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	522	Open in IMG/M
3300021478\|Ga0210402_11115166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	716	Open in IMG/M
3300021560\|Ga0126371_10003773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	13310	Open in IMG/M
3300021560\|Ga0126371_10236057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1938	Open in IMG/M
3300021560\|Ga0126371_10488211	All Organisms → cellular organisms → Bacteria → Proteobacteria	1379	Open in IMG/M
3300021560\|Ga0126371_10602295	All Organisms → cellular organisms → Bacteria → Proteobacteria	1248	Open in IMG/M
3300021560\|Ga0126371_10777570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1104	Open in IMG/M
3300021560\|Ga0126371_12808211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	590	Open in IMG/M
3300021560\|Ga0126371_13386765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	538	Open in IMG/M
3300021560\|Ga0126371_13440459	Not Available	534	Open in IMG/M
3300022530\|Ga0242658_1206285	All Organisms → cellular organisms → Bacteria → Proteobacteria	537	Open in IMG/M
3300025915\|Ga0207693_10086586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2455	Open in IMG/M
3300025915\|Ga0207693_10527253	All Organisms → cellular organisms → Bacteria → Proteobacteria	921	Open in IMG/M
3300025915\|Ga0207693_11355942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	530	Open in IMG/M
3300025928\|Ga0207700_11183739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	682	Open in IMG/M
3300025928\|Ga0207700_11790348	All Organisms → cellular organisms → Bacteria → Proteobacteria	540	Open in IMG/M
3300025931\|Ga0207644_10464585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1041	Open in IMG/M
3300025934\|Ga0207686_10145320	All Organisms → cellular organisms → Bacteria → Proteobacteria	1644	Open in IMG/M
3300026490\|Ga0257153_1043050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	929	Open in IMG/M
3300026551\|Ga0209648_10057458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3310	Open in IMG/M
3300027030\|Ga0208240_1031840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	587	Open in IMG/M
3300027648\|Ga0209420_1127249	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300027706\|Ga0209581_1268066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	519	Open in IMG/M
3300027846\|Ga0209180_10250111	Not Available	1020	Open in IMG/M
3300027875\|Ga0209283_10550389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	737	Open in IMG/M
3300027903\|Ga0209488_10216511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Hartmannibacter → Hartmannibacter diazotrophicus	1442	Open in IMG/M
3300027905\|Ga0209415_10932708	Not Available	586	Open in IMG/M
3300027908\|Ga0209006_10009147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8942	Open in IMG/M
3300027908\|Ga0209006_10841135	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300027952\|Ga0209889_1027314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1261	Open in IMG/M
3300028792\|Ga0307504_10328095	All Organisms → cellular organisms → Bacteria → Proteobacteria	584	Open in IMG/M
3300028877\|Ga0302235_10293095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	704	Open in IMG/M
3300029701\|Ga0222748_1018055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1001	Open in IMG/M
3300029943\|Ga0311340_10019658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8476	Open in IMG/M
3300030020\|Ga0311344_11134326	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300031231\|Ga0170824_108961832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	804	Open in IMG/M
3300031238\|Ga0265332_10001922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10999	Open in IMG/M
3300031545\|Ga0318541_10631156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	599	Open in IMG/M
3300031561\|Ga0318528_10757839	Not Available	519	Open in IMG/M
3300031573\|Ga0310915_10668787	Not Available	734	Open in IMG/M
3300031708\|Ga0310686_113060733	All Organisms → cellular organisms → Bacteria → Proteobacteria	775	Open in IMG/M
3300031708\|Ga0310686_115115834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	610	Open in IMG/M
3300031724\|Ga0318500_10283676	All Organisms → cellular organisms → Bacteria → Proteobacteria	809	Open in IMG/M
3300031728\|Ga0316578_10027792	Not Available	3199	Open in IMG/M
3300031744\|Ga0306918_10848394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	713	Open in IMG/M
3300031797\|Ga0318550_10193556	All Organisms → cellular organisms → Bacteria → Acidobacteria	983	Open in IMG/M
3300031833\|Ga0310917_10235720	Not Available	1230	Open in IMG/M
3300031833\|Ga0310917_10896333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	597	Open in IMG/M
3300031846\|Ga0318512_10314473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	780	Open in IMG/M
3300031890\|Ga0306925_10111774	All Organisms → cellular organisms → Bacteria → Proteobacteria	2916	Open in IMG/M
3300031890\|Ga0306925_11376675	Not Available	697	Open in IMG/M
3300031890\|Ga0306925_11842703	Not Available	578	Open in IMG/M
3300031912\|Ga0306921_12213701	All Organisms → cellular organisms → Bacteria → Proteobacteria	579	Open in IMG/M
3300031918\|Ga0311367_11567447	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300031941\|Ga0310912_10977608	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300031941\|Ga0310912_11160275	Not Available	589	Open in IMG/M
3300031942\|Ga0310916_10326520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1302	Open in IMG/M
3300031942\|Ga0310916_10381454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1199	Open in IMG/M
3300031947\|Ga0310909_11268092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	594	Open in IMG/M
3300031954\|Ga0306926_11194025	Not Available	894	Open in IMG/M
3300031954\|Ga0306926_11938509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	664	Open in IMG/M
3300031954\|Ga0306926_12894429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	516	Open in IMG/M
3300032001\|Ga0306922_11010285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	858	Open in IMG/M
3300032041\|Ga0318549_10181865	All Organisms → cellular organisms → Bacteria → Acidobacteria	942	Open in IMG/M
3300032160\|Ga0311301_10929890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1165	Open in IMG/M
3300032160\|Ga0311301_11980778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	681	Open in IMG/M
3300032180\|Ga0307471_103519278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	554	Open in IMG/M
3300032205\|Ga0307472_100038612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2858	Open in IMG/M
3300032261\|Ga0306920_100078113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4865	Open in IMG/M
3300032261\|Ga0306920_100657944	All Organisms → cellular organisms → Bacteria	1547	Open in IMG/M
3300032261\|Ga0306920_102612953	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	692	Open in IMG/M
3300032261\|Ga0306920_102643770	Not Available	687	Open in IMG/M
3300032515\|Ga0348332_12208845	All Organisms → cellular organisms → Bacteria → Proteobacteria	608	Open in IMG/M
3300032515\|Ga0348332_14272826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	527	Open in IMG/M
3300032892\|Ga0335081_10001144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	42323	Open in IMG/M
3300032892\|Ga0335081_10942490	All Organisms → cellular organisms → Bacteria	1013	Open in IMG/M
3300032893\|Ga0335069_10879871	All Organisms → cellular organisms → Bacteria → Proteobacteria	1003	Open in IMG/M
3300032893\|Ga0335069_10949423	Not Available	958	Open in IMG/M
3300032896\|Ga0335075_10949223	Not Available	780	Open in IMG/M
3300033433\|Ga0326726_10318019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1463	Open in IMG/M
3300034384\|Ga0372946_0085625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1463	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	89.40%
Host-Associated	Host-Associated	10.60%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	82.95%
Plants	Host-Associated → Plants	9.22%
Aquatic	Environmental → Aquatic	6.45%
Arthropoda	Host-Associated → Arthropoda	0.92%
Fungi	Host-Associated → Fungi	0.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	79.26%
Freshwater	Environmental → Aquatic → Freshwater	5.53%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.15%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.23%
Peat	Environmental → Terrestrial → Peat	2.30%
Roots	Host-Associated → Plants → Roots	1.84%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.92%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.92%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.46%
Sediment	Environmental → Aquatic → Sediment	0.46%
Geologic	Environmental → Terrestrial → Geologic	0.46%
Mycelium	Host-Associated → Fungi → Mycelium	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.23%
Loam	Environmental → Terrestrial → Soil → Loam	18.43%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	9.68%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	4.15%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.30%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.30%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.84%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.84%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.92%
Sand	Environmental → Terrestrial → Soil → Sand	0.92%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.92%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.92%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.46%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.46%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.46%
Unclassified	Environmental → Terrestrial → Geologic → Unclassified	0.46%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	22.58%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	13.82%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.29%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.61%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.30%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.30%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.84%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.84%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.84%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.38%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.92%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.92%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.92%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.92%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.46%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.46%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.46%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.46%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.46%
Unclassified	Environmental → Terrestrial → Geologic → Unclassified → Unclassified	0.46%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.98%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.06%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	10.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.22%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.07%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.07%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.23%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.30%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	2.77%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.77%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.84%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.84%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.38%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.38%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.92%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.92%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.92%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.92%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.92%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.92%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.92%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.92%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.92%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.92%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.92%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.46%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.46%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.46%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.46%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.46%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.46%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.46%
Compost	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost	0.46%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.46%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.46%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.46%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.46%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.46%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.46%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.46%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.46%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.46%
Subsoil	Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Subsoil	0.46%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.46%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.46%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.46%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.46%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001471	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006186	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Host-Associated	Open in IMG/M
3300006195	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Host-Associated	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009820	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60	Environmental	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010963	Subsoil microbial communities from Rio Tinto Huelva, Spain - T211	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012088	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ028 MetaG	Host-Associated	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014165	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG	Environmental	Open in IMG/M
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300014493	Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017932	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4	Environmental	Open in IMG/M
3300017942	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019238	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019248	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020593	Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft MG (version 2)	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Host-Associated	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022530	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300027030	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes)	Environmental	Open in IMG/M
3300027648	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027952	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300028877	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3	Environmental	Open in IMG/M
3300029701	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300029943	I_Palsa_N3 coassembly	Environmental	Open in IMG/M
3300030020	II_Bog_N1 coassembly	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Host-Associated	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Host-Associated	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032041	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300034384	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F021823

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiFebDRAFT_138721262	3300000363	Soil	MITFLRRLAMHYGIYRRYPLAPLPALKNAWRISR*
JGI12712J15308_100405122	3300001471	Forest Soil	MRAFTRRFLMHYGIYRRYPLRRLPALRNAWRTARA*
JGIcombinedJ26739_1013621152	3300002245	Forest Soil	MNAFLRRLLMHYGIYRRYPLGRLPALRNAWRTAQP*
Ga0062384_1004478051	3300004082	Bog Forest Soil	AENKMRAFIRRFLMHYGIYRRYPLGRFPALRNAWRVAQP*
Ga0066388_1000498766	3300005332	Tropical Forest Soil	LNETLMVAFLRRFSLHYGIYRRYPLRPIKALKNAWRIARA*
Ga0066388_1009612062	3300005332	Tropical Forest Soil	MMGVVMRAFVKRLLMHYGIYRRYPLPRLSALRNAWRNARA*
Ga0066388_1047335702	3300005332	Tropical Forest Soil	MGMAMRAFIKRLLMHYGIYRRYPLPPLSAFRNAWRNARA*
Ga0070713_1016635141	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	VGKAMIAFLRRLLMHYGIYRRYPLARFSALRNAWRIARI*
Ga0070738_1000084046	3300005531	Surface Soil	MGLAMRAFIKRFLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0070732_103269822	3300005542	Surface Soil	MRAFIRRFLMHYGIYRRYPLGRLPSLRNAWRNARA*
Ga0066700_106628232	3300005559	Soil	MRAFIRRLLMHYGIYRRYPLRPFPALRNAWRIARV*
Ga0066691_105286141	3300005586	Soil	MRAFIRRLLMHYGIYRRYPLRPLPALRNAWRIARV*
Ga0068856_1006592722	3300005614	Corn Rhizosphere	MIAFIRRLSFHYEIYRGYPLSRFPALKNAWRIART*
Ga0068859_1003429382	3300005617	Switchgrass Rhizosphere	VGFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR*
Ga0066905_1000969282	3300005713	Tropical Forest Soil	MIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARV*
Ga0066905_1010763551	3300005713	Tropical Forest Soil	RTMIAFIRRLFIHYDIYRRYPLARLPALRNAWRIARA*
Ga0066903_1001051592	3300005764	Tropical Forest Soil	MITFLRRLFMHYGIYRRYPLAPLSALKNAWRIARA*
Ga0066903_1001459943	3300005764	Tropical Forest Soil	MNTFVRRLLMHYGIYRRYPLAPLRALRNAWRIARA*
Ga0066903_1002069573	3300005764	Tropical Forest Soil	MITFLRRFFMHYGIYRRYPLAPLSALKNAWRIARA*
Ga0066903_1002215127	3300005764	Tropical Forest Soil	MVAFIRRLAMHYDIYRRYPLARLPALKNAWRIART*
Ga0066903_1002316873	3300005764	Tropical Forest Soil	MHAFLKRFLMHYGIYRRYPLGRLPALRNAWRTARP*
Ga0066903_1002331113	3300005764	Tropical Forest Soil	MIAFIRRLLIHYDIYRRYPLARVPALKNAWRIARP*
Ga0066903_1005182673	3300005764	Tropical Forest Soil	MAAFLRRFALHYGIYRRYPLRPFKALKNAWRIARD*
Ga0066903_1015348573	3300005764	Tropical Forest Soil	MVAFLPRFSLHYAIYRRYPLRPFKALKDASRIARA*
Ga0066903_1020561122	3300005764	Tropical Forest Soil	MVAFLRRFSLHYAIYRRYPLRPFKALKNAWRIARA*
Ga0066903_1027060851	3300005764	Tropical Forest Soil	NCAGINMIAFMRRLSIHYDIYRSYPLARIPALKNAWRISRA*
Ga0066903_1035319023	3300005764	Tropical Forest Soil	MRAFLKRFLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0066903_1042740461	3300005764	Tropical Forest Soil	MRAFIRRFLMQYGIYRRYPLGRLPSLRNAWRNARA*
Ga0066903_1047669762	3300005764	Tropical Forest Soil	MRAFLRRFLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0066903_1051845502	3300005764	Tropical Forest Soil	MRAFIRRFFMHYGIYRRYPLGRLPSLRNAWRNARA*
Ga0066903_1055109301	3300005764	Tropical Forest Soil	MISFCRRFRIHYDIYRRYPLSRVPALRNAWRIARA*
Ga0066903_1077805701	3300005764	Tropical Forest Soil	MRAFIRRFLMHYGIYRRYPLRRLPSLRNAWRNARP*
Ga0066903_1080737082	3300005764	Tropical Forest Soil	MRAFVKRFLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0070766_107944003	3300005921	Soil	MNAFLRRLLMHYGIYRRYPLGRLPALRTAQPKHSNS
Ga0081455_104758922	3300005937	Tabebuia Heterophylla Rhizosphere	MIVFLRRLLFHYGVYRNYPLSPWPALKNAWRIVRI*
Ga0081540_10004744	3300005983	Tabebuia Heterophylla Rhizosphere	MITFIRRFLMHYGIYRRYPLAPLPALRNAWRIARA*
Ga0081539_100593972	3300005985	Tabebuia Heterophylla Rhizosphere	MIVFLRRLLFHYGVYRTYPLSPWPALKNAWRIVRI*
Ga0070717_103640072	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MLGFFRRLLMHYGIYRRYPLRPIPALASAWKIARP*
Ga0075014_1008219751	3300006174	Watersheds	MRAFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA*
Ga0070712_1000689166	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MHAFIKRFLMHYGIYRRYPLGRFPALRNAWRVAQP*
Ga0070712_1001296516	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MVTFIRRFALHYDIYRRYPLARLPALKNAWRISRI*
Ga0070712_1020091382	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	IMVAFLRRFSLHYGVYRRYPLRPIEALKNAWRIARA*
Ga0070765_1000894714	3300006176	Soil	MRAFIRRFLMHYGIYRRYPLGRLPSLRNAWRNARV*
Ga0075367_100905332	3300006178	Populus Endosphere	MHAFIRRFLLHYGINRRYHPLRRLTAARIAWRTARA*
Ga0075369_100024713	3300006186	Populus Endosphere	MMYFFQRLFMHYGIYRRYPLAPLPALKSAWRISR*
Ga0075369_105051491	3300006186	Populus Endosphere	MMSFFQRLFMHYGIYRRYPLAPVPAIKSAWRISR*
Ga0075366_108478161	3300006195	Populus Endosphere	VGFNMISFVRRFVMHYGIYRRYPLAPMPAIKNAWRISR*
Ga0079220_102878571	3300006806	Agricultural Soil	MLGFFRRLLMHYEIYRRYPLRPIPALASAWKIARP*
Ga0075433_109857013	3300006852	Populus Rhizosphere	MIVFLRRLLFHYGVYRNYPLPPWPALKNAWRILRI*
Ga0073928_101619312	3300006893	Iron-Sulfur Acid Spring	MRAFIRRLIMHYGIYRRYPLARLPALRNAWRNARA*
Ga0099829_103726692	3300009038	Vadose Zone Soil	MRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0105242_104829122	3300009176	Miscanthus Rhizosphere	FDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR*
Ga0116220_102364071	3300009525	Peatlands Soil	HAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP*
Ga0126374_106608911	3300009792	Tropical Forest Soil	HPRRVFAMLTFFRRLAMHYGIYRRYPLAPLAALKNAWRIARV*
Ga0105085_10208073	3300009820	Groundwater Sand	MPGVRRTFIERLLFHYEVYRGYPLPRWSALKNAWRIARA*
Ga0123355_102355212	3300009826	Termite Gut	MRAFIRRFFLHYGINRRHPIDPLSAARDAWRIART*
Ga0123355_117323122	3300009826	Termite Gut	MRAFIKRFFLHYGINRRHPVRRLSAVRDAWRIARA*
Ga0126313_116138432	3300009840	Serpentine Soil	MNSFFRRFFMHYGIYRRYPLAHLPALKNAWRISR*
Ga0126384_118065041	3300010046	Tropical Forest Soil	MRAFIRRFFLHYGINRRYPLRRLTAVRNAWRTARA*
Ga0126382_105922332	3300010047	Tropical Forest Soil	MVMRAFVKRLLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0126373_102754792	3300010048	Tropical Forest Soil	MRAFVKRLLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0126373_111618312	3300010048	Tropical Forest Soil	MVAFLRRFSLHYGIYRRYLLRPFKALKNAWRIARD*
Ga0127503_108483222	3300010154	Soil	MIAFFRRLSMHYGIYRRYPLARLSALRNAWRIARA*
Ga0074044_101895712	3300010343	Bog Forest Soil	MHAFLRRFLMHYGIYRRYPLGRLPALRNAWRTARP*
Ga0074044_107727812	3300010343	Bog Forest Soil	MRPFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA*
Ga0126370_102856642	3300010358	Tropical Forest Soil	MLDFFRRLLLHYGIYRRYPLSPLPALKNAWRVART*
Ga0126370_109386282	3300010358	Tropical Forest Soil	MRAFIRRFLLHYGINRRYPLRRLTAVRNAWRTARA*
Ga0126370_116090821	3300010358	Tropical Forest Soil	PKTRRNRSGLNETLMVAFLRRFSLHYGIYRRYPLRPIKALKNAWRIARA*
Ga0126372_104878552	3300010360	Tropical Forest Soil	MLDFFRRLLLHYGIYRRYPLSPLPALKNAWRIART*
Ga0126372_107284121	3300010360	Tropical Forest Soil	MITFFRRLFMHYGIYRRYPLAPLSALKNAWRIARA*
Ga0126372_121380852	3300010360	Tropical Forest Soil	VGKAMIAFIRRLLMHYGIYRRYPLARFSALRNAWRIARI*
Ga0126372_124632562	3300010360	Tropical Forest Soil	MAMRAFIKRLLMHYGIYRRYPLPPLSAFRNAWRNARA*
Ga0126372_132421321	3300010360	Tropical Forest Soil	ETTGVAMRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0126378_103586141	3300010361	Tropical Forest Soil	GLAMRAFVKRFLMHYGIYRRYPLGRLPSFRNAWRNARA*
Ga0126381_1026496072	3300010376	Tropical Forest Soil	VGKAMIAFIRRLLMHYGIYRRYPLARLSALRNAWRIARI*
Ga0136449_1004582062	3300010379	Peatlands Soil	MHAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP*
Ga0136449_1012228342	3300010379	Peatlands Soil	MASMRAFIRRFLMHYGIYRRYPLPRLSAMRNAWRNARA*
Ga0134122_106630962	3300010400	Terrestrial Soil	VDFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR*
Ga0138108_1002545	3300010963	Subsoil	MNAFVRRFVMHYGIYRRYPLARIDALRNAWRIARA*
Ga0137391_100222892	3300011270	Vadose Zone Soil	MLEFYRRLLLHYGIYRRYPLGLLPALKNAWRIART*
Ga0153944_10332651	3300012088	Attine Ant Fungus Gardens	MRVFIRRFLMNYGIYRRYPLPRLSAMRNAWRNARA*
Ga0137389_111329892	3300012096	Vadose Zone Soil	VAMRAFVRRFLMHYGIYRRYPLPRVSAFRNAWRNARA*
Ga0137388_114273082	3300012189	Vadose Zone Soil	MGVAMRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA*
Ga0150985_1103753461	3300012212	Avena Fatua Rhizosphere	MIAFIRRLSLHYDVYRSYPLPRVPALKNAWRIARA*
Ga0150985_1188840851	3300012212	Avena Fatua Rhizosphere	QTVRVMVSFVRRLVMHYGIYRRYPLAPVPAIRNAWRISR*
Ga0137361_108436433	3300012362	Vadose Zone Soil	GVAMRAFVRRFLMHYEIYRRYPLPRLSAVRNAWRNARA*
Ga0150984_1015525873	3300012469	Avena Fatua Rhizosphere	QTVRIMVSFVRRLVMHYGIYRRYPLAPVPAIKNAWRISR*
Ga0150984_1129409701	3300012469	Avena Fatua Rhizosphere	TMIAFIRRLSLHYDVYRSYPLPRVPALKNAWRIARA*
Ga0137419_116938842	3300012925	Vadose Zone Soil	MAMRAFVRRFLMHYGIYRRYPLGRLPAFRNAWRNARA*
Ga0164298_109129551	3300012955	Soil	MVAFLRRFSLHYGIYRRYPLTPFSALKNAWRIARA*
Ga0164303_109248401	3300012957	Soil	MIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARA*
Ga0153916_128097772	3300012964	Freshwater Wetlands	MLPFIRRLLMHYDIYRRYPLRPLPALKNAWRISR*
Ga0126369_110794892	3300012971	Tropical Forest Soil	MHAFLKRFLMHYGIYRRYPLGRLPTLRNAWRTARP*
Ga0181523_103275252	3300014165	Bog	MRAFFRRLVMHYGIYRRYPLRRLSAFRNAWRNARA*
Ga0181534_104979922	3300014168	Bog	MRAFTRRFLMHYGIYRRYPLGRLPALRNAWRTARA*
Ga0182018_104471711	3300014489	Palsa	AFPESLSRRTKMHAFLRRFLMHYGVYRRYPLGLLPSLRNAWRIARA*
Ga0182016_102428971	3300014493	Bog	MQSFVKRFMMHYGIYRRYPLGRLPALRNAWRTSRA*
Ga0182024_118386772	3300014501	Permafrost	MNTFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA*
Ga0137412_101980682	3300015242	Vadose Zone Soil	MGVAMRAFVRRFLMHYEIYRRYPLPRLSAFRNAWRNARA*
Ga0182036_110941462	3300016270	Soil	GETDMQAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP
Ga0182041_104799692	3300016294	Soil	MLAFIKRFLMHYGIYRRYPLGRFPALRNAWRAAMS
Ga0182041_116342081	3300016294	Soil	MIAFLRRLSMHYGIYRRYPLARLSALRNAWRIARA
Ga0182033_101707023	3300016319	Soil	MRTFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA
Ga0182033_105296512	3300016319	Soil	MRAFIKRFLMHYGVYRRYPLGRFPALRNAWRVAQP
Ga0182039_113355041	3300016422	Soil	NRSGLNETLMVAFLPRFSLHYAIYRRYPLRPFKALKDASRIARA
Ga0182038_113503951	3300016445	Soil	TTMIAFLRRLSMHYGIYRRYPLARLSALRNAWRIARA
Ga0187814_104368321	3300017932	Freshwater Sediment	MMGLAMRAFIKRFLMHYGIYRRYPLPRLSAFRNAWRNARA
Ga0187808_102454202	3300017942	Freshwater Sediment	MMGLAMRAFVKRFLMHYGIYRRYPLPRLSAFRNAWRNARA
Ga0187819_101233872	3300017943	Freshwater Sediment	MASMRAFIRRFLMQYGIYRRYPLPRLSAMRNAWRNARA
Ga0187785_102963122	3300017947	Tropical Peatland	MISFIRRFALHYGIYRRYPLGRIPALKNAWRMSRA
Ga0187817_110773591	3300017955	Freshwater Sediment	MRAFIRRFLMQYGIYRRYPLPRLSAMRNAWRNARA
Ga0187783_103450902	3300017970	Tropical Peatland	MRAFVKRLLMHYGIYRRYPLPRLSAFRNAWRNARA
Ga0187783_104744551	3300017970	Tropical Peatland	MAVALAAAQDGNMRAFIRRFLMHYAIYRRYPLGRLPAMRNAWRNARA
Ga0187781_100719232	3300017972	Tropical Peatland	MGADMRAFVRRFLMHYAIYRRYPLRRLPALRNAWRTARA
Ga0187780_112988262	3300017973	Tropical Peatland	MFALPFLNRLWLHYSIYRGYPLRPAAALRNAWRIARR
Ga0187777_110410631	3300017974	Tropical Peatland	MLALPFLNRLWLHYSIYRSYPLRPAAALRNAWRIARR
Ga0187782_104476972	3300017975	Tropical Peatland	MRAFVRRFMMHYGIYRRYPLRRLPAIRNAWRTARA
Ga0187782_108501001	3300017975	Tropical Peatland	MLHFWRRFLLHYGIYRRYPLGPLPALRNAWRIART
Ga0187788_102674501	3300018032	Tropical Peatland	MIAFIRRFALHYGIYRRYPLRRIPALKNAWRMARA
Ga0187863_108941051	3300018034	Peatland	LSRRTKMRPFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA
Ga0187784_105135071	3300018062	Tropical Peatland	MLQFLRRFLLHYGIYRRYPLGPLPALKNAWRIARA
Ga0187784_112203223	3300018062	Tropical Peatland	MRAFFRRFVMHYGIYRRYPLRRLPALRNAWRTARA
Ga0066667_113178902	3300018433	Grasslands Soil	MRAFIRRLLMHYGIYRRYPLRPLPALRNAWRIARV
Ga0190268_102145081	3300018466	Soil	MVMPGLRRTFIERLLFHYEVYRGYPLPRWSALKNAWRIARA
Ga0190271_128716642	3300018481	Soil	MTMMTFLRRLAMHYSIYRRYPLAPLPALKNAWRISR
Ga0180112_12282101	3300019238	Groundwater Sediment	AMRAFVRRFLMHYGIYRRYPLARIPAFRNAWRISRA
Ga0180117_12223742	3300019248	Groundwater Sediment	KGTAMRAFVRRFLMHYGIYRRYPLARIPAFRNAWRISRA
Ga0180221_10159723	3300020593	Compost	MVMLNFVRRLLMHYGIYRRYPLSRLPALKNAWRMAR
Ga0179596_100516202	3300021086	Vadose Zone Soil	MGVAMRAFVRRFLMHYEIYRRYPLPRLSAFRNAWRNARA
Ga0210406_106086082	3300021168	Soil	EHAAGQTMIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARA
Ga0210400_108011012	3300021170	Soil	MRAFIRRLIMHYGIYRRYPLARLPALRNAWRNARA
Ga0210396_110213071	3300021180	Soil	MRAFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA
Ga0210393_113522121	3300021401	Soil	MIAFIRRLSFHYEIYRGYPLSRFPALKNAWRIART
Ga0210385_103255141	3300021402	Soil	FSRRTKMRAFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA
Ga0210397_101993872	3300021403	Soil	MRAFFRRFLMHYGIYRRYPLGLLPALRNAWRTARA
Ga0213871_100213622	3300021441	Rhizosphere	MIAFIRRLLMHYGIYRRYPLARFPALRNAWRIARI
Ga0210392_114050411	3300021475	Soil	ENLMRAFIKRFLMHYGIYRRYPFERFSALRNAWRVAQL
Ga0210402_111151661	3300021478	Soil	MNAFLRRFLMHYGIYRRYPLGRLPALRNAWRIARPL
Ga0126371_1000377311	3300021560	Tropical Forest Soil	MLGFLRRLLLHYAIYRRYPLRPLPALACAWKMARS
Ga0126371_102360571	3300021560	Tropical Forest Soil	MSFLRRLLLHYAIYRRYPLRLRPLPALANAWKMARS
Ga0126371_104882112	3300021560	Tropical Forest Soil	VGKAMIAFIRRLLMHYGIYRRYPLARFSALRNAWRIARI
Ga0126371_106022952	3300021560	Tropical Forest Soil	MRAFVKRFLMHYGIYRRYPLPRLSAFRNAWRNARA
Ga0126371_107775702	3300021560	Tropical Forest Soil	MLDFFRRLLLHYGIYRRYPLSPLPALKNAWRVART
Ga0126371_128082112	3300021560	Tropical Forest Soil	MLALPFFNRLWLHYSVYRTYPLRPFAALRNAWRIARR
Ga0126371_133867651	3300021560	Tropical Forest Soil	MHREQKKRAGTTMRAFVKRLLMHYGIYRRYPLPRISAFRNAWRNAR
Ga0126371_134404592	3300021560	Tropical Forest Soil	MVAFLPRFSLHYAIYRRYPLRPFKALKGGSRIARA
Ga0242658_12062852	3300022530	Soil	MRSFVRRFMMHYGIYRRYPLARLPAIRNAWRTARA
Ga0207693_100865867	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MVTFIRRFALHYDIYRRYPLARLPALKNAWRISRA
Ga0207693_105272531	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	RPRRTEMHAFLKRFLMHYGIYRRYPLGRLPALRNAWRTARP
Ga0207693_113559421	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MVTFIRRFALHYDIYRRYPLARLPALKNAWRISRI
Ga0207700_111837392	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MIAFLRRLLMHYGIYRRYPLARFSALRNAWRIARI
Ga0207700_117903482	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	LDRPRRTEMHAFLKRFLMHYGIYRRYPLGRLPALRNAWRTARP
Ga0207644_104645852	3300025931	Switchgrass Rhizosphere	VGFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR
Ga0207686_101453202	3300025934	Miscanthus Rhizosphere	VDFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR
Ga0257153_10430501	3300026490	Soil	MGVAMRAFVRRFLMHYEIYRRYPLPRLSAFRNAWRNAR
Ga0209648_100574582	3300026551	Grasslands Soil	MRTFVRRFLMHYEIYRRYPLPRLSAFRNAWRNARA
Ga0208240_10318402	3300027030	Forest Soil	MRAFLKRFLMHYGIYRRYPLGLLPALRNAWRTARA
Ga0209420_11272492	3300027648	Forest Soil	MRTFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA
Ga0209581_12680661	3300027706	Surface Soil	MGLAMRAFIKRFLMHYGIYRRYPLPRLSAFRNAWRNARA
Ga0209180_102501111	3300027846	Vadose Zone Soil	MRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA
Ga0209283_105503891	3300027875	Vadose Zone Soil	MRAFVRRFLMHYGIYRRYPLPRVSAFRNAWRNARA
Ga0209488_102165111	3300027903	Vadose Zone Soil	EETIGVAMRAFVRRLLMHYGIYRRYPLPRLSAFRNAWRNARA
Ga0209415_109327081	3300027905	Peatlands Soil	MLALPFLNRLWLHYSIYRSYPLTPTAALRNAWRIARR
Ga0209006_100091479	3300027908	Forest Soil	MRAFTRRFLMHYGIYRRYPLRRLPALRNAWRTARA
Ga0209006_108411351	3300027908	Forest Soil	MNTFLRRFLMHYEVYRRYPLGRLPALRNAWRTARP
Ga0209889_10273142	3300027952	Groundwater Sand	MPGVRRTFIERLLFHYEVYRGYPLPRWSALKNAWRIARA
Ga0307504_103280952	3300028792	Soil	MRAFVRRFLMHYGIYRRYPLAPLPALKNAWRISRA
Ga0302235_102930952	3300028877	Palsa	RPRRTEMHAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP
Ga0222748_10180552	3300029701	Soil	GENKMHAFIRRFLMHYGIYRRYPLGRFPALRNAWRAAQP
Ga0311340_100196582	3300029943	Palsa	MHAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP
Ga0311344_111343262	3300030020	Bog	KMQSFVKRFMMHYGIYRRYPLGRLPALRNAWRTSRA
Ga0170824_1089618323	3300031231	Forest Soil	MRAFIKRFLMHYGIYRRYPLGRFPALRNAWRVAQP
Ga0265332_100019228	3300031238	Rhizosphere	MLEFYRRFFLHYAIYRRYPLGPLPALKNAWRIART
Ga0318541_106311562	3300031545	Soil	VGKAMIAFIRRLLMHYGIYRRYPLARLSALRNAWRIARI
Ga0318528_107578391	3300031561	Soil	MCAFVRRFLMHYGIYRRYPLPRMSAFRNAWRNARA
Ga0310915_106687872	3300031573	Soil	LNETLMVAFLRRFSLHYGIYRRYLLRPFKALKNAWRIARD
Ga0310686_1130607332	3300031708	Soil	MVAPMRAFVRRFLMHYGIYRRYPLRRMTAFRNAWRNARA
Ga0310686_1151158341	3300031708	Soil	MATMRVFIRRFLMHYGIYRRYPLPRLSAMRNAWRIARA
Ga0318500_102836762	3300031724	Soil	MRAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQP
Ga0316578_100277921	3300031728	Rhizosphere	VMRAFFKRFLMHYGIYRRYPLGRVPAIKNAWRISRA
Ga0306918_108483942	3300031744	Soil	MIAFIRRLLMHYGIYRRYPLARLSALRNAWRIARI
Ga0318550_101935562	3300031797	Soil	MHAFIKRFLMHYGVYRRYPLGRFPALRNAWRVAQP
Ga0310917_102357204	3300031833	Soil	HLAWGNLMRAFIKRFLMYYGIYRRYPLRWFAALRNAWRVARS
Ga0310917_108963331	3300031833	Soil	EDSPMRAFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA
Ga0318512_103144732	3300031846	Soil	MRAFVKGFLMHYGIYRRYPLGRFPALRNAWRAAQL
Ga0306925_101117746	3300031890	Soil	MRAFIKRFLMYYGIYRRYPLRWFAALRNAWRVARS
Ga0306925_113766751	3300031890	Soil	MFAFIRRFSIHYNIYRGYPLARLPALKNAWRIARA
Ga0306925_118427031	3300031890	Soil	MVAFLRRFSLHYGIYRRYLLRPFKALKNAWRIARD
Ga0306921_122137011	3300031912	Soil	VAENKMLAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQP
Ga0311367_115674473	3300031918	Fen	MPSFLRRLFFHYGIYRRYPLRPLPALRNAWRIARP
Ga0310912_109776082	3300031941	Soil	MQAFIRRFLMYYGIYRRYPLGRLPALRNAWRVTRDGSAA
Ga0310912_111602751	3300031941	Soil	NKMRAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQL
Ga0310916_103265202	3300031942	Soil	KMRAFIKRFLMHYGIYRRYPLGRFPALRNAWRVAQP
Ga0310916_103814543	3300031942	Soil	MLAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQP
Ga0310909_112680922	3300031947	Soil	MLAFIKRFLMHYGIYRRYPLGRFPALSNAWRAAQP
Ga0306926_111940251	3300031954	Soil	GQTTMIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARA
Ga0306926_119385092	3300031954	Soil	LMRAFIKRFLMHYGIYRRYPLRWFAALRNAWRVARS
Ga0306926_128944292	3300031954	Soil	IPFEDSPMRAFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA
Ga0306922_110102852	3300032001	Soil	MRAFIKRFLMHYGIYRRYPLGRFPALRNAWHVAQP
Ga0318549_101818651	3300032041	Soil	MRAFIKRFLMHYGIYRRYPLGRVPALRNAWRVAQP
Ga0311301_109298902	3300032160	Peatlands Soil	MASMRAFIRRFLMHYGIYRRYPLPRLSAMRNAWRNARA
Ga0311301_119807781	3300032160	Peatlands Soil	MRPFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA
Ga0307471_1035192782	3300032180	Hardwood Forest Soil	MITFLRRLFMHYGIYRRYPLAPLSALKNAWRIARV
Ga0307472_1000386122	3300032205	Hardwood Forest Soil	MITFLRRFFMHYGIYRRYPLDPVSALKNAWRIARV
Ga0306920_1000781132	3300032261	Soil	MRAFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA
Ga0306920_1006579442	3300032261	Soil	MRAFVRRFVMHYGIYRRYPLGRLPSLRNAWRNARA
Ga0306920_1026129531	3300032261	Soil	LAENKMRTFIRRFLMHYGIYRRYPLGRFPALRNAWRVAQP
Ga0306920_1026437702	3300032261	Soil	MVAFLPRFSLHYAIYRRYPLRPFKALKDASRIARA
Ga0348332_122088452	3300032515	Plant Litter	MASMRAFIHRFLMHYGIYRRYPLPRLSAMRNAWRIARA
Ga0348332_142728262	3300032515	Plant Litter	MRAFVQRFLMHYGIYRRYPLARLPALRNAWRTSRA
Ga0335081_1000114412	3300032892	Soil	MTGFLRRLLLHYAIYRRYPLRPLPALANAWKMARS
Ga0335081_109424902	3300032892	Soil	MIGFLRRLLLHYTIYRRYPLRPLPALANAWKMARS
Ga0335069_108798712	3300032893	Soil	MRAFTRRFLMHYGIYRRYPLGRLPALRNAWRTARA
Ga0335069_109494231	3300032893	Soil	MPSFVRRLIFHYGIYRRYPLRPLPALRNAWRIARA
Ga0335075_109492231	3300032896	Soil	MLSGRNFIDRLLFHYDVYRSYPLSPWAALRNAWRIAR
Ga0326726_103180193	3300033433	Peat Soil	SAEKDTEMRAFVRRFIMHYGIYRRYPLARIPAFRNAWRISRA
Ga0372946_0085625_956_1069	3300034384	Soil	MLSRRSFIDRLVFHYDVYRRYPLPPWAALRNAWRIAR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign