| Basic Information | |
|---|---|
| Taxon OID | 3300010947 Open in IMG/M |
| Scaffold ID | Ga0138905_1566507 Open in IMG/M |
| Source Dataset Name | Termite gut microbial communities - laboratory nests. Combined Assembly of Gp0151227, Gp0151152, Gp0151149, Gp0151146 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Luxembourg, Luxembourg Institute of Science and Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 504 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | France | |||||||
| Coordinates | Lat. (o) | 48.913957 | Long. (o) | 2.485499 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001002 | Metagenome | 809 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138905_15665072 | F001002 | N/A | CLKVNNLTLILLTKENGELLIMPANRRWDLIRALKG* |
| ⦗Top⦘ |