Basic Information | |
---|---|
Taxon OID | 3300010931 Open in IMG/M |
Scaffold ID | Ga0137937_1015281 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_U1383E_lower_OATZ |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1058 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → environmental samples → uncultured Woeseiaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From North Pond, Atlantic Mid-Ocean Ridge. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pond, Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 22.8 | Long. (o) | -46.05 | Alt. (m) | Depth (m) | 4425 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103292 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137937_10152812 | F103292 | AGG | MNLTWRFETQVPYGRFIAVVSEDGAGYSARIEGKIVASPRPGDSNIAVRVIRDRYYGPESVAERSLEVLRRAVEEKIEHDIGTVNRWSVEPS* |
⦗Top⦘ |